KRT81 Recombinant Protein Antigen

Images

 
There are currently no images for KRT81 Recombinant Protein Antigen (NBP2-57133PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KRT81 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KRT81.

Source: E. coli

Amino Acid Sequence: AESWYRSKCEEMKATVIRHGETLRRTKEEINELN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KRT81
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57133.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KRT81 Recombinant Protein Antigen

  • ghHb1
  • ghHkb1
  • Hair keratin K2.9
  • hard keratin, type II, 1
  • Hb-1
  • hHAKB2-1
  • K81
  • keratin 81
  • Keratin, hair, basic, 1MLN 137
  • keratin, type II cuticular Hb1
  • keratin-81
  • KRTHB1HB1
  • Metastatic lymph node 137 gene protein
  • MLN137
  • Type II hair keratin Hb1
  • Type-II keratin Kb21

Background

KRT81 is encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB3 and KRTHB6, is found primarily in the hair cortex. Mutations in this gene and KRTHB6 have been observed in patients with a rare dominant hair disease, monilethrix. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
NB600-804
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
H00003889-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-04382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBL1-12400
Species: Hu
Applications: WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
255-SC
Species: Hu
Applications: BA
NBP3-52107
Species: Hu, Mu
Applications: Flow,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
H00003886-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: COMET, CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, mIF, Single-Cell Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
AF644
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
NBP2-57133PEP
Species: Hu
Applications: AC

Publications for KRT81 Recombinant Protein Antigen (NBP2-57133PEP) (0)

There are no publications for KRT81 Recombinant Protein Antigen (NBP2-57133PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT81 Recombinant Protein Antigen (NBP2-57133PEP) (0)

There are no reviews for KRT81 Recombinant Protein Antigen (NBP2-57133PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KRT81 Recombinant Protein Antigen (NBP2-57133PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KRT81 Products

Research Areas for KRT81 Recombinant Protein Antigen (NBP2-57133PEP)

Find related products by research area.

Blogs on KRT81

There are no specific blogs for KRT81, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KRT81 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT81