Home » KRT28 » KRT28 Proteins » Recombinant Human KRT28 Protein

Recombinant Human KRT28 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human KRT28 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 464 of Human KRT28 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGSHAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKGWYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYENELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAGGNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAATFARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQAQIGALEEQLHQVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSPGNSSKDLSKTTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
KRT28
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
77.99 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KRT28 Protein

  • cytokeratin-28
  • K25D
  • K28
  • keratin 25D
  • keratin 28
  • keratin, type I cytoskeletal 28
  • keratin-28
  • KRT25D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TRAIL R2/TNFRSF10B
Antibody
NB100-56618
Western Blot: TRAIL R2/TNFRSF10B Antibody [NB100-56618] - Total protein from HL-60, HepG2, HCT-116 and human placenta was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-TRAIL R2 in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Western Blot: TRAIL R2/TNFRSF10B Antibody [NB100-56618] - Analysis of 20 ug of whole cell lysates from HL60 cells with anti-TRAIL R2/TNFRSF10B at 5 ug/ml. Image using the Azide Free form of this antibody.
Immunocytochemistry/Immunofluorescence: TRAIL R2/TNFRSF10B Antibody [NB100-56618] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-TRAIL R2 (H76) at 5ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(37 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
Immunohistochemistry-Paraffin: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of a formalin fixed paraffin embedded tissue section of human brain (Alzheimers disease, hippocampus) using 1:200 dilution of anti-beta Amyloid antibody (clone MOAB-2). The staining was developed with HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This beta Amyloid antibody specifically stained the cells with Abeta 42/ Abeta aggregates while the normal cells were negative for abeta peptide.
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).
(12 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
pan Cytokeratin
Antibody (AE1 + AE3)
NBP2-29429
Immunohistochemistry-Paraffin: pan Cytokeratin Antibody (AE1 + AE3) [NBP2-29429] - Analysis using Azide and BSA Free version of NBP2-29429. Human Colon Carcinoma stained with pan Cytokeratin Monoclonal Antibody cocktail (AE-1/AE3).
Immunohistochemistry-Paraffin: pan Cytokeratin Antibody (AE1 + AE3) [NBP2-29429] - Pan Cytokeratin was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using 1.7 ug/mL of mouse anti-pan Cytokeratin monoclonal (NBP2-29429, Novus Biologicals) for 1 hour at room temperature followed by anti-mouse IgG VisUCyte HRP polymer(VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue).
Immunocytochemistry/Immunofluorescence: pan Cytokeratin Antibody (AE1 + AE3) [NBP2-29429] - MCF-7 cells stained with Biotin conjugated version of pan Cytokeratin antibody and SAv-A488. A) SAv-A488 only at a dilution of 1:500, B) pan CK at a dilution of 1:200, C) pan CK at a dilution of 1:400, D) pan CK at a dilution of 1:800. Image from verified customer review.
(9 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
Seryl tRNA
synthetase Antibody (
H00006301-M01
Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.
Immunocytochemistry/Immunofluorescence: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on HeLa cell. Antibody concentration 25 ug/ml.
Immunohistochemistry-Paraffin: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.
(4 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
SARS2 Antibody
NBP2-33807
Western Blot: SARS2 Antibody [NBP2-33807] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: SARS2 Antibody [NBP2-33807] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.
Species: Hu
Applications: WB, IHC, IHC-P
Cytokeratin 17
Antibody (E3 (same as ...
NBP2-29421
Western Blot: Cytokeratin 17 Antibody (E3) [NBP2-29421] - Analysis of Cytokeratin 17 in human HeLa lysate using Cytokeratin 17 E3 antibody at 3 ug/ml. goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: Cytokeratin 17 Antibody (E3) [NBP2-29421] - Formalin-paraffin skin stained with CK17 Ab (E3).
Immunohistochemistry-Paraffin: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Formalin-fixed paraffin-embedded human Bladder Carcinoma stained with CK17 Monoclonal Antibody (E3)
(1 Publication)
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
KRT25 Antibody
NBP2-58547
Immunocytochemistry/Immunofluorescence: KRT25 Antibody [NBP2-58547] - Staining of human cell line RPTEC TERT1 shows localization to vesicles.
Immunohistochemistry-Paraffin: KRT25 Antibody [NBP2-58547] - Immunohistochemical staining of human duodenum shows no positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CPVL Antibody
NBP2-38792
Immunocytochemistry/Immunofluorescence: CPVL Antibody [NBP2-38792] - Immunofluorescent staining of human cell line CACO-2 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: CPVL Antibody [NBP2-38792] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CPVL Antibody [NBP2-38792] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
VHLL
Overexpression Lysate
NBL1-17720
Western Blot: VHLL Overexpression Lysate (Adult Normal) [NBL1-17720] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for VHLL.
Species: Hu
Serine Dehydratase
Antibody (OTI3D3)
NBP2-01506
Western Blot: Serine Dehydratase Antibody (3D3) [NBP2-01506] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Serine Dehydratase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by Serine Dehydratase-PAGE and immunoblotted with anti-Serine Dehydratase.
Immunocytochemistry/Immunofluorescence: Serine Dehydratase Antibody (3D3) [NBP2-01506] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Serine Dehydratase.
Immunohistochemistry-Paraffin: Serine Dehydratase Antibody (3D3) [NBP2-01506] - Staining of paraffin-embedded Human breast tissue using anti-Serine Dehydratase mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Bim Antibody
NBP2-53088
Western Blot: Bim Antibody [NBP2-53088] - Total protein from human K562, HeLa, A549, HepG2 cells and mouse Raw264.7 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Bim/BCL2L11 in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Bim Antibody [NBP2-53088] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-Bim at a 1:50 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) [NB100-690] was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Bim Antibody [NBP2-53088] - IHC analysis of a formalin fixed and paraffin embedded tissue section of human endometrial cancer xenograft using Bim antibody at 1:50 dilution. The signal was detected using HRP labeled secondary antibody and DAB staining method which followed counter-staining with hematoxylin. The antibody generated a specific cytoplasmic staining with punctate appearance, signifying Bim/Bcl2L11 presence on mitochondria.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Muscarinic
Acetylcholine Recepto ...
NBP1-87466
Immunocytochemistry/Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human dissociated rat hippocampal culture. Image courtesy of Janosch Heller, University College London.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human cerebral cortex shows high expression.
(1 Review)
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
GNPDA1 Antibody
NBP2-24557
Western Blot: GNPDA1 Antibody [NBP2-24557] - analysis of GNPDA1 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. 25 ug/ml.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-24557] - Formalin-fixed paraffin-embedded human kidney tissue stained with GNPDA1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Cytochrome c
Antibody (7H8.2C12)
NB100-56503
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the Biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 mgs of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.
Immunocytochemistry/Immunofluorescence: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - p73 was detected in immersion fixed Hela human cell line using Cytochrome C [7H8.2C12] Monoclonal Antibody (Catalog # NB100-56503) at 25 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Cytochrome C was detected in immersion fixed paraffin-embedded sections of human heart using anti-human mouse monoclonal antibody (Catalog # NB100-56503) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(47 Publications)
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
KCNN3 Antibody
NBP2-14144
Immunohistochemistry: KCNN3 Antibody [NBP2-14144] - Staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.
Species: Hu
Applications: IHC, IHC-P
KDELR1 Antibody
(KR-10)
NBP2-12873
Western Blot: KDELR1 Antibody (KR-10) [NBP2-12873] - analysis of Rat tissue lysate showing detection of KDEL Receptor protein using Mouse Anti-KDEL Receptor Monoclonal Antibody, Clone KR-10. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-KDEL Receptor Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: KDELR1 Antibody (KR-10) [NBP2-12873] - Tissue: NRK cells. Species: Rat. Primary Antibody: Mouse Anti-KDEL Receptor Monoclonal Antibody at 1:1000. Secondary Antibody: APC Goat Anti-Mouse (red). Counterstain: DAPI (blue) nuclear stain. Courtesy of: Institute of Mol. and Cell Bio, Singapore.
Species: Bv
Applications: WB, ICC/IF, IHC, IHC-P, IP
IGF-I
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(2 Reviews)
(100 Publications)
Species: Hu
NGFI-B
alpha/Nur77/NR4A1 Ant
NB100-56745
Western Blot: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - Analysis of Nur77 (Nak-1) in 15 ugs of NIH3T3 cell lysate using Nur77 antibody at 1:500 dilution
Immunocytochemistry/Immunofluorescence: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-NGFI-B alpha at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - NUR77 antibody was tested in Jurkat cells at a 1:50 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
(11 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP

Publications for KRT28 Recombinant Protein (H00162605-P01) (0)

There are no publications for KRT28 Recombinant Protein (H00162605-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT28 Recombinant Protein (H00162605-P01) (0)

There are no reviews for KRT28 Recombinant Protein (H00162605-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRT28 Recombinant Protein (H00162605-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KRT28 Products

Bioinformatics Tool for KRT28 Recombinant Protein (H00162605-P01)

Discover related pathways, diseases and genes to KRT28 Recombinant Protein (H00162605-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT28

There are no specific blogs for KRT28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KRT28 Recombinant Protein Antigen
NBP2-57281PEP
1 μg/lane of Recombinant Human IGF-I was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
IGF-I [Unconjugated]
291-G1-200
Immunohistochemistry-Paraffin: KRT28 Antibody [NBP2-57281] - Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in subset of Leydig cells.
KRT28 Antibody
NBP2-57281
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the Biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 mgs of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.
Cytochrome c Antibody (7H8.2C12)
NB100-56503

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KRT28 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol KRT28