Recombinant Human KRR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KRR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-381 of Human KRR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK

Protein/Peptide Type
Recombinant Protein
Gene
KRR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KRR1 Protein

  • HIV-1 Rev binding protein 2
  • HIV-1 Rev-binding protein 2
  • HRB2
  • KRR1 small subunit processome component homolog
  • KRR1, small subunit (SSU) processome component, homolog (yeast)
  • Rev interacting protein
  • Rev-interacting protein 1
  • RIP-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NB100-56169
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00011103-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for KRR1 Recombinant Protein (H00011103-P01) (0)

There are no publications for KRR1 Recombinant Protein (H00011103-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRR1 Recombinant Protein (H00011103-P01) (0)

There are no reviews for KRR1 Recombinant Protein (H00011103-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRR1 Recombinant Protein (H00011103-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KRR1 Products

Bioinformatics Tool for KRR1 Recombinant Protein (H00011103-P01)

Discover related pathways, diseases and genes to KRR1 Recombinant Protein (H00011103-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KRR1 Recombinant Protein (H00011103-P01)

Discover more about diseases related to KRR1 Recombinant Protein (H00011103-P01).
 

Pathways for KRR1 Recombinant Protein (H00011103-P01)

View related products by pathway.

PTMs for KRR1 Recombinant Protein (H00011103-P01)

Learn more about PTMs related to KRR1 Recombinant Protein (H00011103-P01).

Blogs on KRR1

There are no specific blogs for KRR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KRR1 Antibody
NBP1-92060

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KRR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KRR1