KRR1 Recombinant Protein Antigen (NBP1-92060PEP)

Images

 
There are currently no images for KRR1 Protein (NBP1-92060PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KRR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KRR1.

Source: E.coli

Amino Acid Sequence: LKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEAD

Protein/Peptide Type
Recombinant Protein Antigen
Gene
KRR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-92060.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KRR1 Recombinant Protein Antigen

  • HIV-1 Rev binding protein 2
  • HIV-1 Rev-binding protein 2
  • HRB2
  • KRR1 small subunit processome component homolog
  • KRR1, small subunit (SSU) processome component, homolog (yeast)
  • Rev interacting protein
  • Rev-interacting protein 1
  • RIP-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NB100-56169
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for KRR1 Protein (NBP1-92060PEP) (0)

There are no publications for KRR1 Protein (NBP1-92060PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRR1 Protein (NBP1-92060PEP) (0)

There are no reviews for KRR1 Protein (NBP1-92060PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for KRR1 Protein (NBP1-92060PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KRR1 Products

Related Products by Gene

Bioinformatics Tool for KRR1 Protein (NBP1-92060PEP)

Discover related pathways, diseases and genes to KRR1 Protein (NBP1-92060PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KRR1 Protein (NBP1-92060PEP)

Discover more about diseases related to KRR1 Protein (NBP1-92060PEP).
 

Pathways for KRR1 Protein (NBP1-92060PEP)

View related products by pathway.

PTMs for KRR1 Protein (NBP1-92060PEP)

Learn more about PTMs related to KRR1 Protein (NBP1-92060PEP).

Blogs on KRR1

There are no specific blogs for KRR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KRR1 Antibody
NBP1-92060
KRR1 Antibody
NBP1-92060
KRR1 Antibody
NBP1-92060

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KRR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KRR1