KPNA5 Antibody

Images

 
Western Blot: KPNA5 Antibody [NBP1-52978] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KPNA5 Antibody Summary

Immunogen
Synthetic peptides corresponding to KPNA5(karyopherin alpha 5 (importin alpha 6)) The peptide sequence was selected from the C terminal of KPNA5. Peptide sequence TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE.
Specificity
This product is specific to Subunit or Isofrom: alpha-6.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KPNA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KPNA5 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KPNA5 Antibody

  • importin alpha 6
  • importin subunit alpha-6
  • IPOA6
  • karyopherin alpha 5 (importin alpha 6)
  • Karyopherin subunit alpha-5
  • SRP6

Background

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-28727
Species: Hu
Applications: IP (-), WB, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-57809
Species: Hu
Applications: ICC/IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP1-80871
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57233
Species: Hu
Applications: WB, ICC/IF
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80880
Species: Hu
Applications: IHC, IHC-P
NBP1-52978
Species: Hu
Applications: WB

Publications for KPNA5 Antibody (NBP1-52978) (0)

There are no publications for KPNA5 Antibody (NBP1-52978).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KPNA5 Antibody (NBP1-52978) (0)

There are no reviews for KPNA5 Antibody (NBP1-52978). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KPNA5 Antibody (NBP1-52978) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KPNA5 Products

Bioinformatics Tool for KPNA5 Antibody (NBP1-52978)

Discover related pathways, diseases and genes to KPNA5 Antibody (NBP1-52978). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KPNA5 Antibody (NBP1-52978)

Discover more about diseases related to KPNA5 Antibody (NBP1-52978).

Blogs on KPNA5

There are no specific blogs for KPNA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KPNA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA5