KMT2B Antibody (4C10) - Azide and BSA Free

Sandwich ELISA: KMT2B Antibody (4C10) [H00009757-M02] - Detection limit for recombinant GST tagged MLL4 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4C10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KMT2B Antibody (4C10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse KMT2B Antibody (4C10) - Azide and BSA Free (H00009757-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MLL4 (NP_055542, 813 a.a. ~ 904 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL
• Specificity: MLL4 - myeloid/lymphoid or mixed-lineage leukemia 4
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KMT2B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KMT2B Antibody (4C10) - Azide and BSA Free

• EC 2.1.1.43
• histone-lysine N-methyltransferase MLL4
• HRX2
• KIAA0304WW domain-binding protein 7
• Lysine N-methyltransferase 2D
• mixed lineage leukemia gene homolog 2
• MLL2
• myeloid/lymphoid or mixed-lineage leukemia 4
• Myeloid/lymphoid or mixed-lineage leukemia protein 4
• Trithorax homolog 2
• trithorax homologue 2
• TRX2
• WBP7
• WBP-7
• WW domain binding protein 7

Background

This gene encodes a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. This gene is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer. Two alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene, however, the full length nature of the shorter transcript is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KMT2B
• Entrez:
  • 9757(Human)
• OMIM:
  • 606834(Human)
• Uniprot:
  • NP_055542(Human)