KLHL7 Antibody - Azide and BSA Free

Western Blot: KLHL7 Antibody [NBP3-03938] - Western blot analysis of extracts of various cell lines, using KLHL7 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Product Discontinued

KLHL7 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human KLHL7 (NP_061334.4). QAEPLIQDNPECLKMVISGMRYHLLSPEDREELVDGTRPRRKKHDYRIALFGGSQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLHL7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000 - 1:5000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for KLHL7 Antibody - Azide and BSA Free

• kelch (Drosophila)-like 6
• kelch/BTB
• kelch-like 6
• kelch-like 7 (Drosophila)
• kelch-like protein 7
• KLHL6
• RP42
• SBBI26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: KLHL7