Recombinant Human KLHDC3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human KLHDC3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 266 of Human KLHDC3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDTQPSSSTTQSSFGAGGMTPKGPAMCSMPLTSADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNWHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNSNISRPIVSSHG

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
KLHDC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
54.89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLHDC3 Protein

  • hPeas
  • kelch domain containing 3
  • kelch domain-containing protein 3
  • PEASdJ20C7.3
  • Protein Peas
  • RP1-20C7.3
  • Testis intracellular mediator protein

Background

KLHDC3( AAH45612, 1 a.a. - 267 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90276
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67909
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-91953
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45387
Species: Hu
Applications: WB, IHC
H00060386-P01
Species: Hu
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00004957-M01
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC
NBP2-01340
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP1-85871
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15447
Species: Hu
Applications: WB
NBP2-03621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02939
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP2-12553
Species: Hu
NBP2-15447
Species: Hu
Applications: WB
H00116138-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for KLHDC3 Recombinant Protein (H00116138-P01) (0)

There are no publications for KLHDC3 Recombinant Protein (H00116138-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHDC3 Recombinant Protein (H00116138-P01) (0)

There are no reviews for KLHDC3 Recombinant Protein (H00116138-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHDC3 Recombinant Protein (H00116138-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional KLHDC3 Products

Bioinformatics Tool for KLHDC3 Recombinant Protein (H00116138-P01)

Discover related pathways, diseases and genes to KLHDC3 Recombinant Protein (H00116138-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHDC3 Recombinant Protein (H00116138-P01)

Discover more about diseases related to KLHDC3 Recombinant Protein (H00116138-P01).

Research Areas for KLHDC3 Recombinant Protein (H00116138-P01)

Find related products by research area.

Blogs on KLHDC3

There are no specific blogs for KLHDC3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLHDC3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHDC3
Novus 100% Guarantee