Recombinant Human KLF5 Protein

Images

 
SDS-Page: Recombinant Human KLF5 Protein [H00000688-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human KLF5 Protein Summary

Description
A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-100 of Human KLF5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KLF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLF5 Protein

  • Basic transcription element-binding protein 2
  • BTEB2
  • BTE-binding protein 2
  • CKLFGC-box-binding protein 2
  • Colon krueppel-like factor
  • colon kruppel-like factor
  • GC box binding protein 2
  • IKLFbasic transcription element binding protein 2
  • Intestinal-enriched krueppel-like factor
  • intestinal-enriched kruppel-like factor
  • KLF5
  • Krueppel-like factor 5
  • Kruppel-like factor 5 (intestinal)
  • Transcription factor BTEB2

Background

KLF5 - Kruppel-like factor 5 (intestinal)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3158
Species: Mu
Applications: WB, ChIP, ICC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-04266
Species: Hu, Mu
Applications: WB, ELISA
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP2-45511
Species: Hu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00000688-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for KLF5 Partial Recombinant Protein (H00000688-Q01) (0)

There are no publications for KLF5 Partial Recombinant Protein (H00000688-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF5 Partial Recombinant Protein (H00000688-Q01) (0)

There are no reviews for KLF5 Partial Recombinant Protein (H00000688-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF5 Partial Recombinant Protein (H00000688-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for KLF5 Partial Recombinant Protein (H00000688-Q01)

Discover related pathways, diseases and genes to KLF5 Partial Recombinant Protein (H00000688-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF5 Partial Recombinant Protein (H00000688-Q01)

Discover more about diseases related to KLF5 Partial Recombinant Protein (H00000688-Q01).
 

Pathways for KLF5 Partial Recombinant Protein (H00000688-Q01)

View related products by pathway.

PTMs for KLF5 Partial Recombinant Protein (H00000688-Q01)

Learn more about PTMs related to KLF5 Partial Recombinant Protein (H00000688-Q01).
 

Research Areas for KLF5 Partial Recombinant Protein (H00000688-Q01)

Find related products by research area.

Blogs on KLF5.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLF5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF5
Entrez