Kirrel2/NEPH3 Antibody

Immunocytochemistry/Immunofluorescence: Kirrel2/NEPH3 Antibody [NBP2-68977] - Staining of human cell line REH shows localization to centrosome. Antibody staining is shown in green.

Product Discontinued

Kirrel2/NEPH3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADASFL
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIRREL2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Kirrel2/NEPH3 Antibody

• DKFZp564A1164
• Filtrin
• FILTRINkin of IRRE-like protein 2
• kin of IRRE like 2 (Drosophila)
• Kin of irregular chiasm-like protein 2
• Kirrel2
• MGC15718
• NEPH3
• NEPH3Nephrin-like protein 3
• nephrin-like 3
• nephrin-like gene 1
• NLG1
• NLG1kin of irregular chiasm-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIRREL2