KIR2DL5/CD158f Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR2DL5/CD158f. Peptide sequence: QLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQA The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KIR2DL5A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for KIR2DL5/CD158f Antibody - BSA Free
Background
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells andsubsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies amonghaplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4,KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and bywhether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduceinhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins withthe short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase bindingprotein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules;thus, KIR proteins are thought to play an important role in regulation of the immune response. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: Flow
Species: Hu
Applications: BA
Species: Hu
Applications: Flow
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu, Mu
Applications: ELISA, IHC
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Publications for KIR2DL5/CD158f Antibody (NBP2-82265) (0)
There are no publications for KIR2DL5/CD158f Antibody (NBP2-82265).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KIR2DL5/CD158f Antibody (NBP2-82265) (0)
There are no reviews for KIR2DL5/CD158f Antibody (NBP2-82265).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KIR2DL5/CD158f Antibody (NBP2-82265) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KIR2DL5/CD158f Products
Research Areas for KIR2DL5/CD158f Antibody (NBP2-82265)
Find related products by research area.
|
Blogs on KIR2DL5/CD158f