Recombinant Human Kindlin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Kindlin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 180-269 of Human C20orf42 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PGLYSKTMTPIYDPINGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FERMT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kindlin Protein

  • C20orf42fermitin family homolog 1
  • chromosome 20 open reading frame 42
  • fermitin family homolog 1 (Drosophila)
  • fermitin family member 1
  • FLJ20116
  • KIND1DTGCU2
  • kindlerin
  • kindlin 1
  • Kindlin syndrome protein
  • Kindlin-1
  • UNC112 related protein 1
  • UNC112A
  • Unc-112-related protein 1
  • URP1FLJ23423

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45641
Species: Hu
Applications: WB, IHC
NBP1-47745
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45727
Species: Hu, Rt, Mk
Applications: WB, IHC
NBP1-81664
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF6466
Species: Hu
Applications: WB
NBP1-80652
Species: Hu
Applications: IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13252
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Kindlin Partial Recombinant Protein (H00055612-Q01) (0)

There are no publications for Kindlin Partial Recombinant Protein (H00055612-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kindlin Partial Recombinant Protein (H00055612-Q01) (0)

There are no reviews for Kindlin Partial Recombinant Protein (H00055612-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kindlin Partial Recombinant Protein (H00055612-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kindlin Products

Bioinformatics Tool for Kindlin Partial Recombinant Protein (H00055612-Q01)

Discover related pathways, diseases and genes to Kindlin Partial Recombinant Protein (H00055612-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kindlin Partial Recombinant Protein (H00055612-Q01)

Discover more about diseases related to Kindlin Partial Recombinant Protein (H00055612-Q01).
 

Pathways for Kindlin Partial Recombinant Protein (H00055612-Q01)

View related products by pathway.

PTMs for Kindlin Partial Recombinant Protein (H00055612-Q01)

Learn more about PTMs related to Kindlin Partial Recombinant Protein (H00055612-Q01).

Blogs on Kindlin

There are no specific blogs for Kindlin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Kindlin Antibody
NBP1-89883
Ezrin Antibody
NBP2-16396

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kindlin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FERMT1