Kif4A Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Kif4A Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kif4A.

  Source: E. coli

  Amino Acid Sequence: SITVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KIF4A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56589.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kif4A Recombinant Protein Antigen

• chromokinesin-A
• chromosome-associated kinesin KIF4A
• FLJ12530
• FLJ12655
• FLJ14204
• FLJ20631
• HSA271784
• KIF4G1
• KIF4KIF4-G1
• kinesin family member 4A

Background

The kinesin superfamily of proteins consists of over forty KIF motor proteins that function in intracellular transport along microtubules. Kinesin activity has been linked to various cellular functions such as vesicle transport, mitotic spindle formation, chromosome segregation, and cytokinesis. Structurally, all kinesins contain a motor domain with microtubule and nucleotide binding sites that utilize ATP to target cargo along microtubule filaments. KIF14 silencing experiments suggest that KIF14 plays a multi-functional role in mitosis and cytokinesis. KIF4A has been shown to be essential for cytokinesis. KIF4A is also known as kinesin family member 4A, chromosome-associated kinesin KIF4A, chromokinesin, KIF4, KIF4-G1, FLJ12530, FLJ12655, FLJ14204, FLJ20631, and HSA271784.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KIF4A