We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Kif4A Recombinant Protein Antigen

Images

 
There are currently no images for Kif4A Recombinant Protein Antigen (NBP2-56589PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kif4A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kif4A.

Source: E. coli

Amino Acid Sequence: SITVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF4A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56589.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kif4A Recombinant Protein Antigen

  • chromokinesin-A
  • chromosome-associated kinesin KIF4A
  • FLJ12530
  • FLJ12655
  • FLJ14204
  • FLJ20631
  • HSA271784
  • KIF4G1
  • KIF4KIF4-G1
  • kinesin family member 4A

Background

The kinesin superfamily of proteins consists of over forty KIF motor proteins that function in intracellular transport along microtubules. Kinesin activity has been linked to various cellular functions such as vesicle transport, mitotic spindle formation, chromosome segregation, and cytokinesis. Structurally, all kinesins contain a motor domain with microtubule and nucleotide binding sites that utilize ATP to target cargo along microtubule filaments. KIF14 silencing experiments suggest that KIF14 plays a multi-functional role in mitosis and cytokinesis. KIF4A has been shown to be essential for cytokinesis. KIF4A is also known as kinesin family member 4A, chromosome-associated kinesin KIF4A, chromokinesin, KIF4, KIF4-G1, FLJ12530, FLJ12655, FLJ14204, FLJ20631, and HSA271784.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56923
Species: Hu
Applications: ICC/IF
NBP1-88856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00010362-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00011004-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP2-37550
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
NBP1-90119
Species: Hu
Applications: IHC,  IHC-P
NB500-180
Species: Hu, Ma, Mu, Po, Rt
Applications: ICC/IF, IP, KO, Simple Western, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-21667
Species: Hu
Applications: ELISA, ICC/IF, IHC, PAGE, WB

Publications for Kif4A Recombinant Protein Antigen (NBP2-56589PEP) (0)

There are no publications for Kif4A Recombinant Protein Antigen (NBP2-56589PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kif4A Recombinant Protein Antigen (NBP2-56589PEP) (0)

There are no reviews for Kif4A Recombinant Protein Antigen (NBP2-56589PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kif4A Recombinant Protein Antigen (NBP2-56589PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kif4A Products

Array NBP2-56589PEP

Research Areas for Kif4A Recombinant Protein Antigen (NBP2-56589PEP)

Find related products by research area.

Blogs on Kif4A

There are no specific blogs for Kif4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kif4A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF4A