KIF3A Antibody

Images

 
Western Blot: KIF3A Antibody [NBP1-58179] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF3A Antibody Summary

Immunogen
Synthetic peptides corresponding to KIF3A (kinesin family member 3A) The peptide sequence was selected from the C terminal of KIF3A. Peptide sequence PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KIF3A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIF3A Antibody

  • KIF3
  • kinesin family member 3A
  • kinesin family protein 3A
  • kinesin-like protein KIF3A
  • Microtubule plus end-directed kinesin motor 3A

Background

KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81512
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-17055
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-81568
Species: Hu
Applications: IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-58179
Species: Hu
Applications: WB

Publications for KIF3A Antibody (NBP1-58179) (0)

There are no publications for KIF3A Antibody (NBP1-58179).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF3A Antibody (NBP1-58179) (0)

There are no reviews for KIF3A Antibody (NBP1-58179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF3A Antibody (NBP1-58179) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF3A Products

Bioinformatics Tool for KIF3A Antibody (NBP1-58179)

Discover related pathways, diseases and genes to KIF3A Antibody (NBP1-58179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF3A Antibody (NBP1-58179)

Discover more about diseases related to KIF3A Antibody (NBP1-58179).
 

Pathways for KIF3A Antibody (NBP1-58179)

View related products by pathway.

PTMs for KIF3A Antibody (NBP1-58179)

Learn more about PTMs related to KIF3A Antibody (NBP1-58179).

Blogs on KIF3A

There are no specific blogs for KIF3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF3A
Uniprot