KIF3A Antibody


Western Blot: KIF3A Antibody [NBP1-58179] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

KIF3A Antibody Summary

Synthetic peptides corresponding to KIF3A (kinesin family member 3A) The peptide sequence was selected from the C terminal of KIF3A. Peptide sequence PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KIF3A and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIF3A Antibody

  • KIF3
  • kinesin family member 3A
  • kinesin family protein 3A
  • kinesin-like protein KIF3A
  • Microtubule plus end-directed kinesin motor 3A


KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB

Publications for KIF3A Antibody (NBP1-58179) (0)

There are no publications for KIF3A Antibody (NBP1-58179).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF3A Antibody (NBP1-58179) (0)

There are no reviews for KIF3A Antibody (NBP1-58179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF3A Antibody (NBP1-58179) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KIF3A Products

Bioinformatics Tool for KIF3A Antibody (NBP1-58179)

Discover related pathways, diseases and genes to KIF3A Antibody (NBP1-58179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF3A Antibody (NBP1-58179)

Discover more about diseases related to KIF3A Antibody (NBP1-58179).

Pathways for KIF3A Antibody (NBP1-58179)

View related products by pathway.

PTMs for KIF3A Antibody (NBP1-58179)

Learn more about PTMs related to KIF3A Antibody (NBP1-58179).

Blogs on KIF3A

There are no specific blogs for KIF3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KIF3A Antibody and receive a gift card or discount.


Gene Symbol KIF3A