Home » KIF16B » KIF16B Antibodies » KIF16B Antibody (2B5)

KIF16B Antibody (2B5)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: KIF16B Antibody (2B5) [H00055614-M05] - Detection limit for recombinant GST tagged KIF16B is 0.3 ng/ml as a capture antibody.
Sandwich ELISA: KIF16B Antibody (2B5) [H00055614-M05] - Detection limit for recombinant GST tagged KIF16B is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

KIF16B Antibody (2B5) Summary

Immunogen
KIF16B (AAH34984, 65 a.a. ~ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DDLKDPIKISIPRYVLCGQGKDAHFEFEVKLAALEFPPKKLFGNKDERVIAERRSHLEKYLRDFFSVMLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYSSHGTG
Specificity
Reacts with kinesin family member 16B.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KIF16B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KIF16B Antibody (2B5)

  • C20orf23
  • chromosome 20 open reading frame 23
  • dJ971B4.1
  • FLJ20135
  • KIAA1590
  • kinesin family member 16B
  • kinesin-like protein KIF16B
  • KISC20ORF
  • SNX23kinesin motor protein
  • sorting nexin 23
  • Sorting nexin-23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

KIF21A Antibody
NBP2-37969
Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding KIF21A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
KIF17 Antibody
NBP1-81409
Immunocytochemistry/Immunofluorescence: KIF17 Antibody [NBP1-81409] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: KIF17 Antibody [NBP1-81409] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: KIF17 Antibody [NBP1-81409] - Staining of human testis shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Eg5 Antibody
NB500-181
Western Blot: Eg5 Antibody [NB500-181] - Human Eg5 rescues depletion of the Drosophila kinesin-5 family member Klp61F. Western blot analysis of cell lysates prepared from induced and uninduced; control and Klp61F RNAi-treated cells blotted with anti-Eg5 to monitor induction of Eg5-mCherry, anti-Klp61F to confirm depletion of the motor and anti-alpha-tubulin as a loading control. Cells depleted of Klp61F and with Eg5-mCherry induced are referred to as RepEg5 cells. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fonc.2013.00187/abstract), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Eg5 Antibody [NB500-181] - Staining of HeLa cells fixed in 3.5% paraformaldehyde. Cytoplasmic staining during interphase and spindle staining during mitosis.
Western Blot: Eg5 Antibody [NB500-181] - Cells were transfected with the pCMV6-ENTRY control or pCMV6-ENTRY KIF11 cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Eg5.
(2 Reviews)
(18 Publications)
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
FGFR2 Antibody
(OTI5C5)
NBP2-00932
Flow Cytometry: FGFR2 Antibody (5C5) [NBP2-00932] - Analysis of Hela cells, using anti-FGFR2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: FGFR2 Antibody (5C5) [NBP2-00932] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-FGFR2 antibody, and then analyzed by flow cytometry.
Western Blot: FGFR2 Antibody (5C5) [NBP2-00932] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY FGFR2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-FGFR2.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ARF6 Antibody
(JF101-2)
NBP2-67165
Immunocytochemistry/Immunofluorescence: ARF6 Antibody (JF101-2) [NBP2-67165] - Staining ARF6 in Hela cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ARF6 Antibody (JF101-2) [NBP2-67165] - Staining ARF6 in HepG2 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ARF6 Antibody (JF101-2) [NBP2-67165] - Staining ARF6 in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
KIF3A Antibody
NBP2-76942
Western Blot: KIF3A Antibody [NBP2-76942] - Western blot analysis of KIF3A on rat testis tissue (1) and Daudi cell (2) lysates using anti-KIF3A antibody at 1/500 dilution.
Immunohistochemistry: KIF3A Antibody [NBP2-76942] - Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue using anti-KIF3A antibody. Counter stained with hematoxylin.
Immunohistochemistry: KIF3A Antibody [NBP2-76942] - Immunohistochemical analysis of paraffin-embedded mouse testis tissue using anti-KIF3A antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Polycystin 2
Antibody
NBP3-06363
Western Blot: Polycystin 2 Antibody [NBP3-06363] - Anti-PKD2 rabbit polyclonal antibody at 1:500 dilutionLane A: HeLa Whole Cell LysateLane B: HEK293 Whole Cell LysateLane C: NIH3T3 Whole Cell LysateLysates/proteins at 30 ug per lane.SecondaryGoat Anti-Rabbit IgG (H+L) HRP at 110000 dilution.Developed using the ECL technique.Performed under reducing conditions.Predicted band size: 97 kDa
Immunoprecipitation: Polycystin 2 Antibody [NBP3-06363] - PKD2 was immunoprecipitated using:Lane A:0.5 mg HeLa Whole Cell Lysate4 uL anti-PKD2 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein AG. Primary antibody:Anti-PKD2 rabbit polyclonal antibody, at 1:100 dilution Secondary antibody:Goat Anti-Rabbit IgG (H+L) HRP at 110000 dilutionDeveloped using the ECL technique.Performed under reducing conditions.Predicted band size: 97 kDaObserved band size: 80 kDa
Immunocytochemistry/Immunofluorescence: Polycystin 2 Antibody [NBP3-06363] - Immunofluorescence staining of PKD2 in HeLa cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS,blocked with 10% serum, and incubated with rabbit anti-Human PKD2 polyclonal antibody (dilution ratio 1:200) at 4 degrees celsius overnight. Then cells were stained with the Alexa Fluor (TM) 488-conjugated Goat Anti-rabbit IgG secondary antibody (green) and counterstained with DAPI (blue).Positive staining was localized to Cytoplasm.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
KIF13B Antibody
NBP1-83398
Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: KIF13B Antibody [NBP1-83398] - Staining in human parathyroid gland and skeletal muscle tissues using anti-KIF13B antibody. Corresponding KIF13B RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Kinesin 5B Antibody
NBP2-21667
Western Blot: Kinesin 5B Antibody [NBP2-21667] - Glucocorticoid promoted microtubule destabilization and following transport impairment. The hippocampus of mice exposed to rapamycin (8 mg/kg) for 2 days before corticosterone (10 mg/kg) for 24 h was collected and lysed. alpha-tubulin was co-immunoprecipitated with an anti-kinesin-1 antibody (the left side). Expression of kinesin-1 and alpha-tubulin in total cell lysates is shown in the right side. ** indicates p < 0.01 vs. vehicle. # indicates p < 0.05 vs. corticosterone alone. n = 4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-018-1172-y) licensed under a CC-BY licence.
Immunohistochemistry: Kinesin 5B Antibody [NBP2-21667] - 40X in human brain at pH 6. Tissue: Human Brain.
Western Blot: Kinesin 5B Antibody [NBP2-21667] - Western Blot of Kinesin 5B antibody. Lane 1: 500 ng of truncated kinesin 1 protein. Lane 2: 20 ug of Mouse Brain lysate. Lane 3: 10 ug of Mouse Brain lysate. Primary antibody: kinesin1 antibody at 1:1000 for overnight at 4C.Secondary antibody: IRDye800(TM) rabbit secondary antibody at 1:40,000 for 1hr at RT.Block: 5% BLOTTO 1 hr at RT.Predicted/Observed size: 72 kDa, ~70 kDa for Kinesin 5B. Other band(s): degradation.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, PAGE, WB
PIWIL1/HIWI
Antibody
AF6548
PIWIL1/HIWI was detected in perfusion fixed frozen sections of mouse testes using Goat Anti-Human PIWIL1/HIWI Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6548) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to the cytoplasm of spermatocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Hu, Mu
Applications: IHC
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(45 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
FoxH1 Antibody
[Unconjugated]
AF4248
FoxH1 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
Carboxypeptidase
E/CPE Antibody [Uncon ...
AF3587
A172 human glioblastoma cell line was stained with Goat Anti-Human Carboxypeptidase E/CPE Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3587, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with methanol and saponin.
Carboxypeptidase E/CPE was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Goat Anti-Human Carboxypeptidase E/CPE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3587) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Carboxypeptidase E/CPE was detected in immersion fixed frozen sections of mouse embryo (9.5 d.p.c.) using Goat Anti-Human Carboxypeptidase E/CPE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3587) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to the developing liver. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
KIF1B Antibody
NB100-57493
Western Blot: KIF1B Antibody [NB100-57493] - Detection of Human and Mouse KIF1B on HeLa whole cell lysate using NB100-57493. KIF1B was also immunoprecipitated by rabbit anti-KIF1B antibody NB100-57494.
(3 Publications)
Species: Hu, Mu
Applications: IP, WB
NMDAR2B Antibody
NB300-106
Western Blot: NMDAR2B Antibody [NB300-106] - The blots show the examples of immunobands against NMDAR2B (C) and beta-actin antibodies on the membrane, which was performed on the membrane protein prepared from the lumbar spinal cords of the offspring (P14) rats in different groups. Image collected and cropped by CiteAb from the following publication (http://www.jbiomedsci.com/content/18/1/64) licensed under a CC-BY licence.
Flow Cytometry: NMDAR2B Antibody [NB300-106] - NMDA2B receptor expression on CD4+ T cells. Image supplied by review from confirmed customer.
Western Blot: NMDAR2B Antibody [NB300-106]
(3 Reviews)
(16 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
SLC10A3 Antibody
NBP1-84957
Western Blot: SLC10A3 Antibody [NBP1-84957] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-529
Immunohistochemistry-Paraffin: SLC10A3 Antibody [NBP1-84957] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
ATP5G3 GST (N-Term) P ...
H00000518-P01
SDS-Page: Recombinant Human ATP5G3 Protein [H00000518-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
TNKS2 Antibody
NBP2-20675
Western Blot: TNKS2 Antibody [NBP2-20675] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with Tankyrase 2 antibody [N1], N-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: TNKS2 Antibody [NBP2-20675] - Analysis of paraformaldehyde-fixed HeLa, using TNKS2 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Species: Hu
Applications: ICC/IF, WB
NuMA Antibody
NB500-174
Immunocytochemistry/Immunofluorescence: NuMA Antibody [NB500-174] - Dynactin and NuMA display specific, steady-state binding at mitotic minus-ends. See also Figure 1-figure supplement 1 and Videos 1-3. Representative immunofluorescence image showing co-localization of NuMA (green) and p150 (dynactin subunit; cyan) at microtubule minus-ends in mitotic PtK2 cells (post-NEB) fixed after washout of 5 uM nocodazole. Scale bar, 10 um. Inset: zoom of white box, with 1 um scale bar. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/29328), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: NuMA Antibody [NB500-174] - Human HeLa cells fixed with 3.5% formaldehyde and stained with NB500-174 at 1:1000. The staining pattern shows the typical pattern for NuMA in the cell nucleus during interphase and on spindles during mitosis.
Western Blot: NuMA Antibody [NB500-174] - Analysis of NuMA expression in Cos7 whole cell lysate.
(20 Publications)
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Actin Gamma 1
Antibody
NB600-533
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Detection of human and mouse Cytoskeletal Actin by western blot. Samples: Whole cell lysate (15 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Cytoskeletal Actin antibody NB600-533 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Whole cell lysate from HeLa (1, 2.5, 5, 15 and 50 ug) and mouse NIH3T3 cells (50 ug), probed with diluted at 0.04 ug/ml.
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Knockdown of DLK in differentiated Neuro-2a cells. Neuro-2a cells were infected with an empty lentiviral vector (pLKO.1) or with lentivirus expressing mouse DLK shRNAs (sh73 and sh69). After infection and selection with puromycin, cells were subjected to differentiation for 24 h before being processed for total RNA extraction and whole-cell extracts. Representative Western blots showing levels of DLK, phospho-JNK (p-JNK), total JNK, phospho-c-Jun (p-c-Jun) and actin in infected Neuro-2a cells. Image collected and cropped by CiteAb from the following publication (http://neuraldevelopment.biomedcentral.com/articles/10.1186/s13064-016-0068-8), licensed under a CC-BY licence.
(6 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB

Publications for KIF16B Antibody (H00055614-M05) (0)

There are no publications for KIF16B Antibody (H00055614-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF16B Antibody (H00055614-M05) (0)

There are no reviews for KIF16B Antibody (H00055614-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF16B Antibody (H00055614-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF16B Products

Array H00055614-M05

Bioinformatics Tool for KIF16B Antibody (H00055614-M05)

Discover related pathways, diseases and genes to KIF16B Antibody (H00055614-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF16B Antibody (H00055614-M05)

Discover more about diseases related to KIF16B Antibody (H00055614-M05).
 

Pathways for KIF16B Antibody (H00055614-M05)

View related products by pathway.

Research Areas for KIF16B Antibody (H00055614-M05)

Find related products by research area.

Blogs on KIF16B

There are no specific blogs for KIF16B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF16B Antibody (2B5) and receive a gift card or discount.


Bioinformatics

Gene Symbol KIF16B
Entrez
Uniprot