KIF15 Recombinant Protein Antigen

Images

 
There are currently no images for KIF15 Recombinant Protein Antigen (NBP3-17874PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIF15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF15

Source: E. coli

Amino Acid Sequence: RPVPKLSPEMGSFGSLYTQNSSILDNDILNEPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17874.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KIF15 Recombinant Protein Antigen

  • FLJ25667
  • HKLP2
  • kinesin family member 15
  • kinesin-like 7
  • Kinesin-like protein 2
  • Kinesin-like protein 7
  • kinesin-like protein KIF15
  • KLP2
  • KNSL7
  • NY-BR-62
  • Serologically defined breast cancer antigen NY-BR-62

Background

Plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly (By similarity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-179
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NBP2-56923
Species: Hu
Applications: ICC/IF
NBP1-88856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-19676
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-87689
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB500-182
Species: Hu, Ma, Mu, Rt
Applications: ICC/IF, IP, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-92603
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-40844
Species: Hu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-21667
Species: Hu
Applications: ELISA, ICC/IF, IHC, PAGE, WB
NB500-174
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-38794
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-83722
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for KIF15 Recombinant Protein Antigen (NBP3-17874PEP) (0)

There are no publications for KIF15 Recombinant Protein Antigen (NBP3-17874PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF15 Recombinant Protein Antigen (NBP3-17874PEP) (0)

There are no reviews for KIF15 Recombinant Protein Antigen (NBP3-17874PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIF15 Recombinant Protein Antigen (NBP3-17874PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIF15 Products

Array NBP3-17874PEP

Blogs on KIF15.

Ki67 - an established marker for labelling proliferating cells
Ki-67/MKI67 is an antigen which is expressed during G1, S, G2, and M phases of the cell cycle (mitotically active cells), but not during G0 phase (resting cells). It is a large protein with expected molecular weight of about 395 kDa, and it has a v...  Read full blog post.

Ki67 - A Crucial Cellular Proliferation Marker
The Ki67 antigen is a prototypic cell cycle-related protein expressed by proliferating cells in all phases of the active cell cycle (G1, S, G2 and M). It is a non-histone nuclear protein originally identified in a Hodgkin's lymphoma-derived cell line....  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF15