KIAA0319 Antibody


Western Blot: KIAA0319 Antibody [NBP1-59471] - HepG2 cell lysate, concentration 1.25ug/ml.
Immunohistochemistry-Paraffin: KIAA0319 Antibody [NBP1-59471] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

KIAA0319 Antibody Summary

Synthetic peptides corresponding to KIAA0319(KIAA0319) The peptide sequence was selected from the N terminal of KIAA0319. Peptide sequence EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against KIAA0319 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIAA0319 Antibody

  • 4930451E12Rik
  • D130043K22
  • DLX2
  • DYLX2
  • dyslexia susceptibility 2
  • DYX2
  • KIAA0319
  • MGC176717
  • NMIG


KIAA0319 has been strongly associated with developmental dyslexia.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Rt
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KIAA0319 Antibody (NBP1-59471) (0)

There are no publications for KIAA0319 Antibody (NBP1-59471).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA0319 Antibody (NBP1-59471) (0)

There are no reviews for KIAA0319 Antibody (NBP1-59471). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIAA0319 Antibody (NBP1-59471) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KIAA0319 Products

Bioinformatics Tool for KIAA0319 Antibody (NBP1-59471)

Discover related pathways, diseases and genes to KIAA0319 Antibody (NBP1-59471). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA0319 Antibody (NBP1-59471)

Discover more about diseases related to KIAA0319 Antibody (NBP1-59471).

Pathways for KIAA0319 Antibody (NBP1-59471)

View related products by pathway.

PTMs for KIAA0319 Antibody (NBP1-59471)

Learn more about PTMs related to KIAA0319 Antibody (NBP1-59471).

Blogs on KIAA0319

There are no specific blogs for KIAA0319, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KIAA0319 Antibody and receive a gift card or discount.


Gene Symbol KIAA0319