KIAA0319 Antibody

Images

 
Western Blot: KIAA0319 Antibody [NBP1-59471] - HepG2 cell lysate, concentration 1.25ug/ml.
Immunohistochemistry-Paraffin: KIAA0319 Antibody [NBP1-59471] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

KIAA0319 Antibody Summary

Immunogen
Synthetic peptides corresponding to KIAA0319(KIAA0319) The peptide sequence was selected from the N terminal of KIAA0319. Peptide sequence EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG.
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0319
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against KIAA0319 and was validated on Western Blot and immunohistochemistry-paraffin

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KIAA0319 Antibody

  • DLX2
  • DYLX2
  • dyslexia susceptibility 2
  • DYX2
  • KIAA0319
  • MGC176717

Background

KIAA0319 has been strongly associated with developmental dyslexia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2806
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-13752
Species: Hu
Applications: IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
NBP1-46178
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006936-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00079932-B01P
Species: Hu
Applications: WB, ELISA
NBP2-33795
Species: Hu
Applications: WB, IHC, IHC-P
NB100-55411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-92498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31844
Species: Hu
Applications: IHC, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-30914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76567
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF1440
Species: Mu
Applications: WB
NBP1-49575
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for KIAA0319 Antibody (NBP1-59471) (0)

There are no publications for KIAA0319 Antibody (NBP1-59471).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA0319 Antibody (NBP1-59471) (0)

There are no reviews for KIAA0319 Antibody (NBP1-59471). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIAA0319 Antibody (NBP1-59471) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA0319 Antibody Products

Related Products by Gene

Bioinformatics Tool for KIAA0319 Antibody (NBP1-59471)

Discover related pathways, diseases and genes to KIAA0319 Antibody (NBP1-59471). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA0319 Antibody (NBP1-59471)

Discover more about diseases related to KIAA0319 Antibody (NBP1-59471).
 

Pathways for KIAA0319 Antibody (NBP1-59471)

View related products by pathway.

PTMs for KIAA0319 Antibody (NBP1-59471)

Learn more about PTMs related to KIAA0319 Antibody (NBP1-59471).

Blogs on KIAA0319

There are no specific blogs for KIAA0319, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol KIAA0319

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59471 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought