Kelch-Like 3 Antibody


Western Blot: Kelch-Like 3 Antibody [NBP2-14168] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Kelch-Like 3 Antibody [NBP2-14168] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Kelch-Like 3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAH
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kelch-Like 3 Protein (NBP2-14168PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kelch-Like 3 Antibody

  • FLJ40871
  • kelch-like 3 (Drosophila)
  • kelch-like protein 3
  • KIAA1129kelch (Drosophila)-like 3
  • MGC44594


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC-P, IP
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, IP
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF

Publications for Kelch-Like 3 Antibody (NBP2-14168) (0)

There are no publications for Kelch-Like 3 Antibody (NBP2-14168).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kelch-Like 3 Antibody (NBP2-14168) (0)

There are no reviews for Kelch-Like 3 Antibody (NBP2-14168). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kelch-Like 3 Antibody (NBP2-14168) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kelch-Like 3 Products

Bioinformatics Tool for Kelch-Like 3 Antibody (NBP2-14168)

Discover related pathways, diseases and genes to Kelch-Like 3 Antibody (NBP2-14168). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kelch-Like 3 Antibody (NBP2-14168)

Discover more about diseases related to Kelch-Like 3 Antibody (NBP2-14168).

Pathways for Kelch-Like 3 Antibody (NBP2-14168)

View related products by pathway.

PTMs for Kelch-Like 3 Antibody (NBP2-14168)

Learn more about PTMs related to Kelch-Like 3 Antibody (NBP2-14168).

Blogs on Kelch-Like 3

There are no specific blogs for Kelch-Like 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kelch-Like 3 Antibody and receive a gift card or discount.


Gene Symbol KLHL3