KCTD6 Antibody

Images

 
Western Blot: KCTD6 Antibody [NBP1-80095] - Transfected 293T, Antibody Titration: 5.0ug/ml
Immunohistochemistry-Paraffin: KCTD6 Antibody [NBP1-80095] - Human Lung Alveolar cells (indicated with arrows), 16ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCTD6 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human KCTD6. Peptide sequence: HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCTD6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against KCTD6 and was validated on Western Blot and immunohistochemistry.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KCTD6 Antibody

  • BTB/POZ domain-containing protein KCTD6
  • MGC27385
  • potassium channel tetramerisation domain containing 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71805
Species: Hu
Applications: WB, IP
NB100-58788
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-88818
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-47412
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81563
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80095
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KCTD6 Antibody (NBP1-80095) (0)

There are no publications for KCTD6 Antibody (NBP1-80095).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCTD6 Antibody (NBP1-80095) (0)

There are no reviews for KCTD6 Antibody (NBP1-80095). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCTD6 Antibody (NBP1-80095) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KCTD6 Antibody (NBP1-80095)

Discover related pathways, diseases and genes to KCTD6 Antibody (NBP1-80095). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCTD6 Antibody (NBP1-80095)

Discover more about diseases related to KCTD6 Antibody (NBP1-80095).

PTMs for KCTD6 Antibody (NBP1-80095)

Learn more about PTMs related to KCTD6 Antibody (NBP1-80095).

Blogs on KCTD6

There are no specific blogs for KCTD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCTD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCTD6
Uniprot