We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

KCNMB3 Recombinant Protein Antigen

Images

 
There are currently no images for KCNMB3 Protein (NBP1-83066PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KCNMB3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNMB3.

Source: E. coli

Amino Acid Sequence: TCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNMB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83066.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KCNMB3 Recombinant Protein Antigen

  • BK channel subunit beta-3
  • BKbeta3
  • Hbeta3
  • KCNMB2
  • KCNMBL
  • potassium large conductance calcium-activated channel, subfamily M beta member3
  • slo-beta-3
  • subfamily M subunit beta-3
  • voltage and Ca2+ activated potassium channel Maxi K beta 3subunit

Background

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. At least four transcript variants encoding four different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-48775
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB300-535
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-56583
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85823
Species: Hu
Applications: IHC,  IHC-P, WB
DTSP10
Species: Hu
Applications: ELISA
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC,  IHC-P, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
DY1177-05
Species: Hu
Applications: ELISA
291-G1
Species: Hu
Applications: BA
H00001181-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-48848
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
2308-VN
Species: Hu
Applications: BA
NBP2-24582
Species: Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF4940
Species: Hu, Mu
Applications: ICC
MAB197
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
AF432
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-83066PEP
Species: Hu
Applications: AC

Publications for KCNMB3 Protein (NBP1-83066PEP) (0)

There are no publications for KCNMB3 Protein (NBP1-83066PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNMB3 Protein (NBP1-83066PEP) (0)

There are no reviews for KCNMB3 Protein (NBP1-83066PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KCNMB3 Protein (NBP1-83066PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCNMB3 Products

Research Areas for KCNMB3 Protein (NBP1-83066PEP)

Find related products by research area.

Blogs on KCNMB3

There are no specific blogs for KCNMB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KCNMB3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNMB3