KCNK18 Antibody

Western Blot: KCNK18 Antibody [NBP1-81570] - Analysis in control (vector only transfected HEK293T lysate) and KCNK18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: KCNK18 Antibody [NBP1-81570] - Staining of human cerebellum shows moderate membranous and cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: KCNK18 Antibody [NBP1-81570] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Product Discontinued

KCNK18 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILSTSYNRFRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNK18
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KCNK18 Antibody

• K2p18.1
• potassium channel subfamily K member 18
• potassium channel, subfamily K, member 18
• TRESK2
• TRESK-2
• TRESKTWIK-related spinal cord potassium channel
• TRIKMGR13
• TWIK-related individual K+ channel
• TWIK-related individual potassium channel
• TWIK-related spinal cord K+ channel

Background

Outward rectifying potassium channel. Produces rapidly activating outward rectifier K(+) currents. Mayfunction as background potassium channel that sets the resting membrane potential. Inhibited by arachidonic acid andother naturally occurring unsaturated free fatty acids. Channel activity is enhanced by volatile anesthetics, such asisoflurane

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNK18