KCNK13 Antibody Blocking Peptide Summary
| Description |
A recombinant protein antigen 15 amino acids near the center of human KCNK13. Source: E. coli
Amino Acid Sequence: DSTVIWRVLYNQGKQWLEATIQLGRLSQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEGLDHFWCRHTRACIEKLRLCD
Store KCNK13 Antibody Blocking Peptide at -20C, stable for one year.
|
| Protein/Peptide Type |
Antibody Blocking Peptide |
| Gene |
KCNK13 |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
KCNK13 peptide is used for blocking the activity of KCNK13 antibody NBP2-41132. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS pH 7.2 (10 mM NaH2PO4, 10 mM Na2HPO4, 130 mM NaCl) containing 0.1% bovine serum albumin |
| Preservative |
0.02% Sodium Azide |
| Concentration |
0.2 mg/ml |
Alternate Names for KCNK13 Antibody Blocking Peptide
Background
The KCNK13 gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Bv, Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: B/N
Publications for KCNK13 Protein (NBP2-41132PEP) (0)
There are no publications for KCNK13 Protein (NBP2-41132PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KCNK13 Protein (NBP2-41132PEP) (0)
There are no reviews for KCNK13 Protein (NBP2-41132PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for KCNK13 Protein (NBP2-41132PEP) (0)
Additional KCNK13 Products
Research Areas for KCNK13 Protein (NBP2-41132PEP)
Find related products by research area.
|
Blogs on KCNK13