KCNK13 Antibody Blocking Peptide

Western blot analysis of KCNK13 in rat brain tissue lysate with KCNK13 antibody at 0.5 ug/mL in (A) the absence and (B) the presence of blocking peptide.

• Reactivity: Hu
• Applications: B/N
• Concentration: 0.2 mg/ml

KCNK13 Antibody Blocking Peptide Summary

• Description: A recombinant protein antigen 15 amino acids near the center of human KCNK13.
  
  

  Source: E. coli

  Amino Acid Sequence: DSTVIWRVLYNQGKQWLEATIQLGRLSQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEGLDHFWCRHTRACIEKLRLCD

  
  
  Store KCNK13 Antibody Blocking Peptide at -20C, stable for one year.

• Protein/Peptide Type: Antibody Blocking Peptide
• Gene: KCNK13

Applications/Dilutions

• Dilutions:
  • Block/Neutralize
• Application Notes: KCNK13 peptide is used for blocking the activity of KCNK13 antibody NBP2-41132.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS pH 7.2 (10 mM NaH2PO4, 10 mM Na2HPO4, 130 mM NaCl) containing 0.1% bovine serum albumin
• Preservative: 0.02% Sodium Azide
• Concentration: 0.2 mg/ml

Alternate Names for KCNK13 Antibody Blocking Peptide

• K2p13.1
• potassium channel subfamily K member 13
• potassium channel, subfamily K, member 13
• tandem pore domain potassium channel THIK-1
• THIK-1

Background

The KCNK13 gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KCNK13
• Uniprot:
  • NP_071337(Human)