Recombinant Human KCNIP4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human KCNIP4 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-250 of Human KCNIP4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
KCNIP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
53.24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KCNIP4 GST (N-Term) Protein

  • A-type potassium channel modulatory protein 4
  • Calsenilin-like protein
  • KChIP4
  • KCHIP4CALPMGC44947
  • Kv channel interacting protein 4
  • Kv channel-interacting protein 4
  • potassium channel interacting protein 4
  • Potassium channel-interacting protein 4

Background

KCNIP4( AAH32520, 1 a.a. - 251 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00030818-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP3-03748
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-19020
Species: Hu, Mu, Rt, Po, Bv
Applications: WB
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP2-76945
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-28870
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-19755
Species: Hu, Mu
Applications: WB
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-32263
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-87562
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43694
Species: Hu
Applications: WB, ICC/IF, IP
H00080333-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for KCNIP4 Recombinant Protein (H00080333-P01) (0)

There are no publications for KCNIP4 Recombinant Protein (H00080333-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNIP4 Recombinant Protein (H00080333-P01) (0)

There are no reviews for KCNIP4 Recombinant Protein (H00080333-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNIP4 Recombinant Protein (H00080333-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional KCNIP4 Products

Bioinformatics Tool for KCNIP4 Recombinant Protein (H00080333-P01)

Discover related pathways, diseases and genes to KCNIP4 Recombinant Protein (H00080333-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNIP4 Recombinant Protein (H00080333-P01)

Discover more about diseases related to KCNIP4 Recombinant Protein (H00080333-P01).
 

Pathways for KCNIP4 Recombinant Protein (H00080333-P01)

View related products by pathway.

PTMs for KCNIP4 Recombinant Protein (H00080333-P01)

Learn more about PTMs related to KCNIP4 Recombinant Protein (H00080333-P01).
 

Research Areas for KCNIP4 Recombinant Protein (H00080333-P01)

Find related products by research area.

Blogs on KCNIP4

There are no specific blogs for KCNIP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KCNIP4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNIP4