Recombinant Human KAT6B-MORF Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human KAT6B-MORF Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 80-172 of Human KAT6B-MORF

Source: Wheat Germ

Amino Acid Sequence: FSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KAT6B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KAT6B-MORF Protein

  • DKFZp313G1618
  • FLJ90335
  • Histone acetyltransferase MORF
  • Histone acetyltransferase MOZ2
  • histone acetyltransferase MYST4
  • KAT6B
  • KIAA0383
  • Monocytic leukemia zinc finger protein-related factor
  • MORFMorf
  • MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4
  • MOZ2EC 2.3.1.48
  • MOZ-related factor
  • MYST histone acetyltransferase (monocytic leukemia) 4
  • MYST-4
  • qkf
  • querkopf

Background

MYST4 - MYST histone acetyltransferase (monocytic leukemia) 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57745
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-92161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB100-55251
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88351
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-07996
Species: Hu
NBP2-66163
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
46420002
Species: Hu
Applications: WB, ELISA
H00023522-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for KAT6B-MORF Partial Recombinant Protein (H00023522-Q01) (0)

There are no publications for KAT6B-MORF Partial Recombinant Protein (H00023522-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT6B-MORF Partial Recombinant Protein (H00023522-Q01) (0)

There are no reviews for KAT6B-MORF Partial Recombinant Protein (H00023522-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KAT6B-MORF Partial Recombinant Protein (H00023522-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KAT6B-MORF Products

Bioinformatics Tool for KAT6B-MORF Partial Recombinant Protein (H00023522-Q01)

Discover related pathways, diseases and genes to KAT6B-MORF Partial Recombinant Protein (H00023522-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAT6B-MORF Partial Recombinant Protein (H00023522-Q01)

Discover more about diseases related to KAT6B-MORF Partial Recombinant Protein (H00023522-Q01).
 

Pathways for KAT6B-MORF Partial Recombinant Protein (H00023522-Q01)

View related products by pathway.

PTMs for KAT6B-MORF Partial Recombinant Protein (H00023522-Q01)

Learn more about PTMs related to KAT6B-MORF Partial Recombinant Protein (H00023522-Q01).

Blogs on KAT6B-MORF

There are no specific blogs for KAT6B-MORF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KAT6B-MORF Antibody
NBP1-80324-100ul

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KAT6B-MORF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT6B