KAT2A/GCN5 Antibody (4F9)

Images

 
Western Blot: KAT2A/GCN5 Antibody (4F9) [H00002648-M03] - Analysis of GCN5L2 expression in MCF-7 (Cat # L046V1).
Western Blot: KAT2A/GCN5 Antibody (4F9) [H00002648-M03] - Analysis of GCN5L2 expression in A-549 (Cat # L025V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KAT2A/GCN5 Antibody (4F9) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Specificity
GCN5L2 - GCN5 general control of amino-acid synthesis 5-like 2 (yeast) (4F9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KAT2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KAT2A/GCN5 Antibody (4F9)

  • EC 2.3.1.48
  • GCN5 general control of amino-acid synthesis 5-like 2 (yeast)
  • GCN5L2
  • GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2
  • GCN5MGC102791
  • General control of amino acid synthesis protein 5-like 2
  • General control of amino acid synthesis, yeast, homolog-like 2
  • HGCN5
  • Histone acetyltransferase GCN5
  • histone acetyltransferase KAT2A
  • hsGCN5
  • K(lysine) acetyltransferase 2A
  • KAT2A
  • KAT2A/GCN5
  • Lysine acetyltransferase 2A
  • PCAF-B
  • STAF97

Background

KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It alsofunctions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA(MIM 164014) in a HAT-independent manner (Mao et al., 2009 (PubMed 19339690)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KAT2A/GCN5 Antibody (H00002648-M03) (0)

There are no publications for KAT2A/GCN5 Antibody (H00002648-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT2A/GCN5 Antibody (H00002648-M03) (0)

There are no reviews for KAT2A/GCN5 Antibody (H00002648-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KAT2A/GCN5 Antibody (H00002648-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KAT2A/GCN5 Products

Research Areas for KAT2A/GCN5 Antibody (H00002648-M03)

Find related products by research area.

Blogs on KAT2A/GCN5

There are no specific blogs for KAT2A/GCN5, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KAT2A/GCN5 Antibody (4F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT2A
Entrez
Uniprot