KAT2A/GCN5 Antibody (4F9) Summary
Immunogen |
GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK |
Specificity |
GCN5L2 - GCN5 general control of amino-acid synthesis 5-like 2 (yeast) (4F9) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
KAT2A |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for KAT2A/GCN5 Antibody (4F9)
Background
KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It alsofunctions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA(MIM 164014) in a HAT-independent manner (Mao et al., 2009 (PubMed 19339690)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: EnzAct
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, PAGE, WB
Publications for KAT2A/GCN5 Antibody (H00002648-M03) (0)
There are no publications for KAT2A/GCN5 Antibody (H00002648-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KAT2A/GCN5 Antibody (H00002648-M03) (0)
There are no reviews for KAT2A/GCN5 Antibody (H00002648-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KAT2A/GCN5 Antibody (H00002648-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KAT2A/GCN5 Products
Bioinformatics Tool for KAT2A/GCN5 Antibody (H00002648-M03)
Discover related pathways, diseases and genes to KAT2A/GCN5 Antibody (H00002648-M03). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for KAT2A/GCN5 Antibody (H00002648-M03)
Discover more about diseases related to KAT2A/GCN5 Antibody (H00002648-M03).
| | Pathways for KAT2A/GCN5 Antibody (H00002648-M03)
View related products by pathway.
|
PTMs for KAT2A/GCN5 Antibody (H00002648-M03)
Learn more about PTMs related to KAT2A/GCN5 Antibody (H00002648-M03).
| | Research Areas for KAT2A/GCN5 Antibody (H00002648-M03)
Find related products by research area.
|
Blogs on KAT2A/GCN5