We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Kallikrein 7 Recombinant Protein Antigen

Images

 
There are currently no images for Kallikrein 7 Protein (NBP2-38950PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kallikrein 7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KLK7.

Source: E. coli

Amino Acid Sequence: AHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KLK7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38950.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kallikrein 7 Recombinant Protein Antigen

  • EC 3.4.21
  • EC 3.4.21.117
  • hK7
  • hSCCE
  • kallikrein 7 (chymotryptic, stratum corneum)
  • Kallikrein 7
  • kallikrein-related peptidase 7
  • KLK7
  • protease, serine, 6
  • PRSS6
  • SCCEkallikrein-7
  • Serine protease 6
  • signal protein
  • Stratum corneum chymotryptic enzyme

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded enzyme is thought to be involved in the proteolysis of intercellular cohesive structures preceding desquamation, which is the shedding of the outermost layer of the epidermis. Alternative splicing of this gene results in two transcript variants encoding the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1108-SE
Species: Hu
Applications: EnzAct
MAB2337
Species: Hu
Applications: IP, WB
AF2624
Species: Hu, Mu
Applications: IHC, IP, WB
1719-SE
Species: Hu
Applications: EnzAct
2025-SE
Species: Hu
Applications: EnzAct
AF2008
Species: Hu
Applications: IHC, IP, WB
2626-SE
Species: Hu
Applications: EnzAct
AF944
Species: Hu
Applications: IHC, WB
NBP1-90510
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DKK300
Species: Hu
Applications: ELISA
AF5725
Species: Hu
Applications: IHC
AF1595
Species: Hu
Applications: IHC, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-87528
Species: Hu
Applications: ICC/IF,  IHC-P
H00005655-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DPI00
Species: Hu
Applications: ELISA
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for Kallikrein 7 Protein (NBP2-38950PEP) (0)

There are no publications for Kallikrein 7 Protein (NBP2-38950PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 7 Protein (NBP2-38950PEP) (0)

There are no reviews for Kallikrein 7 Protein (NBP2-38950PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kallikrein 7 Protein (NBP2-38950PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kallikrein 7 Products

Research Areas for Kallikrein 7 Protein (NBP2-38950PEP)

Find related products by research area.

Blogs on Kallikrein 7

There are no specific blogs for Kallikrein 7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kallikrein 7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK7