Kallikrein 14 Antibody - Azide and BSA Free Summary
| Immunogen |
KLK14 (ENSP00000156499, 1 a.a. - 251 a.a.) full-length human protein. MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
KLK14 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Kallikrein 14 Antibody - Azide and BSA Free
Background
Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. The novel KLK gene, KLK14 is expressed by both benign and malignant glandular epithelial cells, thus exhibiting an expression pattern similar to that of two other prostatic kallikreins, KLK2 and KLK3.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Publications for Kallikrein 14 Antibody (H00043847-B01P) (0)
There are no publications for Kallikrein 14 Antibody (H00043847-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kallikrein 14 Antibody (H00043847-B01P) (0)
There are no reviews for Kallikrein 14 Antibody (H00043847-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kallikrein 14 Antibody (H00043847-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kallikrein 14 Products
Research Areas for Kallikrein 14 Antibody (H00043847-B01P)
Find related products by research area.
|
Blogs on Kallikrein 14