Recombinant Human KAL1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human KAL1 GST (N-Term) Protein Summary

Description
Recombinant protein with a N-terminal GST tagcorresponding to the amino acids 548 - 657 of Human KAL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRTPELPP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ANOS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Publications
Read Publication using H00003730-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KAL1 GST (N-Term) Protein

  • Adhesion molecule-like X-linked
  • ADMLXHHA
  • anosmin-1
  • KAL
  • KALIG1
  • KALIG-1
  • Kallmann syndrome 1 sequence
  • Kallmann syndrome interval gene 1
  • Kallmann syndrome protein
  • Kallmann syndrome-1 sequence (anosmin-1)
  • KMS

Background

KAL1 - Kallmann syndrome 1 sequence

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP1-45218
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-43853
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45298
Species: Hu, Rt
Applications: WB, Flow, IHC, IHC-P, IF
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS1927
Species: Hu, Po, Bv, Gt
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-77393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB300-506
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P

Publications for KAL1 Partial Recombinant Protein (H00003730-Q01)(1)

Reviews for KAL1 Partial Recombinant Protein (H00003730-Q01) (0)

There are no reviews for KAL1 Partial Recombinant Protein (H00003730-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KAL1 Partial Recombinant Protein (H00003730-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional KAL1 Products

Bioinformatics Tool for KAL1 Partial Recombinant Protein (H00003730-Q01)

Discover related pathways, diseases and genes to KAL1 Partial Recombinant Protein (H00003730-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAL1 Partial Recombinant Protein (H00003730-Q01)

Discover more about diseases related to KAL1 Partial Recombinant Protein (H00003730-Q01).
 

Pathways for KAL1 Partial Recombinant Protein (H00003730-Q01)

View related products by pathway.

PTMs for KAL1 Partial Recombinant Protein (H00003730-Q01)

Learn more about PTMs related to KAL1 Partial Recombinant Protein (H00003730-Q01).

Blogs on KAL1

There are no specific blogs for KAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KAL1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ANOS1