JPH1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

JPH1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JPH1.
  
  

  Source: E. coli

  Amino Acid Sequence: KADAADQAALAARQECDIARAVARELSPDFYQPGPDYVKQRFQEGVDAKENPEEKVPEKPPTPKESPHFYRKGTTPPRSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIVNK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: JPH1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83076.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for JPH1 Recombinant Protein Antigen

• DKFZp762L0313
• JP-1junctophilin type1
• JP1junctophilin-1
• junctophilin 1
• Junctophilin type 1
• mitsugumin72

Background

JPH1 is a gene which codes for a protein that contributes to the formation of skeletal muscles, as well as a membrane complex which links the plasma membrane to the endoplasmic/sarcoplasmic reticulum as well as serves as a structural base for communication between the cell surface and intracellular calcium channels and is 661 amino acids long, weighing approximately 72 kDa. Current studies are being done on diseases and disorders related to this gene such as pneumonia, malaria, and neuronitis. JPH1 has also been shown to have interactions with SMAD3, TP63, TP73, JPH2, and JPH3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: JPH1