Josephin1 Antibody

Images

 
Immunohistochemistry-Paraffin: Josephin1 Antibody [NBP1-87864] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Josephin1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
JOSD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Josephin1 Protein (NBP1-87864PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Josephin1 Antibody

  • EC 3.4.19.12
  • Josephin domain containing 1
  • Josephin domain-containing 1
  • Josephin-1
  • JSPH1
  • KIAA0063dJ508I15.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
H00007004-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-92756
Species: Hu, Mu, Ch, Re
Applications: WB
NBP1-93456
Species: Hu
Applications: IHC, IHC-P
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4070
Species: Hu
Applications: WB, ICC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-38235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56709
Species: Hu
Applications: WB
H00009097-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
NBP1-87864
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Josephin1 Antibody (NBP1-87864) (0)

There are no publications for Josephin1 Antibody (NBP1-87864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Josephin1 Antibody (NBP1-87864) (0)

There are no reviews for Josephin1 Antibody (NBP1-87864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Josephin1 Antibody (NBP1-87864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Josephin1 Products

Bioinformatics Tool for Josephin1 Antibody (NBP1-87864)

Discover related pathways, diseases and genes to Josephin1 Antibody (NBP1-87864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Josephin1 Antibody (NBP1-87864)

Discover more about diseases related to Josephin1 Antibody (NBP1-87864).
 

Pathways for Josephin1 Antibody (NBP1-87864)

View related products by pathway.

Blogs on Josephin1

There are no specific blogs for Josephin1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Josephin1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol JOSD1