Recombinant Human JMJD1B Protein

Images

 
SDS-Page: Recombinant Human JMJD1B Protein [H00051780-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human JMJD1B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-759 of Human JMJD1B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSEKEAMMMVEPHQKVAWKRAVRGVREMCDVCETTLFNIHWVCRKCGFGVCLDCYRLRKSRPRSETEEMGDEEVFSWLKCAKGQSHEPENLMPTQIIPGTALYNIGDMVHAARGKWGIKANCPCISRQNKSVLRPAVTNGMSQLPSINPSASSGNETTFSGGGGPAPVTTPEPDHVPKADSTDIRSEEPLKTDSSASNSNSELKAIRPPCPDTAPPSSALHWLADLATQKAKEETKEAGSLRSVLNKESHSPFGLDSFNSTAKVSPLTPKLFNSLLLGPTASNNKTEGSSLRDLLHSGPGKLPQTPLDTGIPFPPVFSTSSAGVKSKASLPNFLDHIIASVVENKKTSDASKRACNLTDTQKEVKEMVMGLNVLDPHTSHSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQPVLVSGVHKKLKSELWKPEAFSQEFGDQDVDLVNCRNCAIISDVKVRDFWDGFEIICKRLRSEDGQPMVLKLKDWPPGEDFRDMMPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNIIYHAVKDAVGTLKAHESKLARS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
KDM3B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human JMJD1B Protein

  • C5orf7
  • EC 1.14.11
  • EC 1.14.11.-
  • JHDM2B
  • JmjC domain-containing histone demethylation protein 2B
  • JMJD1B
  • jumonji domain containing 1B
  • Jumonji domain-containing protein 1B
  • KIAA1082chromosome 5 open reading frame 7
  • lysine (K)-specific demethylase 3B
  • lysine-specific demethylase 3B
  • NET22,5qNCA
  • Nuclear protein 5qNCA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49601
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40585
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-77072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-49600
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-74605
Species: Hu, Mu
Applications: WB, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-24672
Species: Hu
Applications: WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00091833-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
1670-SE
Species: Ec
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051780-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for JMJD1B Recombinant Protein (H00051780-P01) (0)

There are no publications for JMJD1B Recombinant Protein (H00051780-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JMJD1B Recombinant Protein (H00051780-P01) (0)

There are no reviews for JMJD1B Recombinant Protein (H00051780-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JMJD1B Recombinant Protein (H00051780-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JMJD1B Products

Bioinformatics Tool for JMJD1B Recombinant Protein (H00051780-P01)

Discover related pathways, diseases and genes to JMJD1B Recombinant Protein (H00051780-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JMJD1B Recombinant Protein (H00051780-P01)

Discover more about diseases related to JMJD1B Recombinant Protein (H00051780-P01).
 

Pathways for JMJD1B Recombinant Protein (H00051780-P01)

View related products by pathway.

PTMs for JMJD1B Recombinant Protein (H00051780-P01)

Learn more about PTMs related to JMJD1B Recombinant Protein (H00051780-P01).

Blogs on JMJD1B

There are no specific blogs for JMJD1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Thrombopoietin/Tpo
288-TP-005/CF
JMJD1B Antibody
NBP1-77071

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human JMJD1B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM3B