JIP2 Antibody - BSA Free

Western Blot: JIP2 Antibody [NBP3-09334] - Western blot analysis of JIP2 in Rat Testis lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

JIP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit JIP2 Antibody - BSA Free (NBP3-09334) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat JIP2 (XP_001055248). Peptide sequence SEPEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSP
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAPK8IP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 90 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for JIP2 Antibody - BSA Free

• C-Jun-amino-terminal kinase-interacting protein 2
• homologous to mouse JIP-1
• IB-2
• IB2JIP2Mitogen-activated protein kinase 8-interacting protein 2
• islet-brain 2
• islet-brain-2
• JIP-2
• JNK MAP kinase scaffold protein 2
• JNK MAP kinase scaffold protein JIP2
• JNK-interacting protein 2
• mitogen-activated protein kinase 8 interacting protein 2
• PRKM8 interacting protein-like
• PRKM8IPL

Background

c-Jun NH2-terminal kinases (JNKs) are distant members of the MAP kinase family. JNK1 is activated by dual phosphorylation at a Thr-Pro-Tyr motif in response to ultraviolet (UV) light, and it functions to phosphorylate c-Jun at amino terminal serine regulatory sites, Ser 63 and Ser 73, resulting in transcriptional activation. Two additional JNK family members have been identified as JNK2 and JNK3. JIP-1 (for JNK interacting protein-1) has been identified as a cytoplasmic inhibitor of JNK that retains JNK in the cytoplasm, thereby inhibiting JNK-regulated gene expression. Evidence suggests that JNK1 and JNK2 bind to JIP-1 with greater affinity than to ATF-2 and c-Jun, which are targets of the JNK signaling pathway. JIP-1 contains an amino terminal JNK binding domain and a carboxy terminal SH3 domain. ATF-2 and c-Jun also contain the JNK binding domain and are thought to compete with JIP-1 for JNK binding. Multiple splice variants of JIP-1, including JIP-1b, JIP-1c (also designated islet-brain 1 or IB-1), JIP-2a, JIP-2b and JIP-3, have been identified in brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPK8IP2