ITPKB Antibody [PE]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: PE

ITPKB Antibody [PE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human ITPKB (NP_002212.3).
  
  Sequence:
  MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSPGRGASFLFPPAESLSPEEPRSPGGWRSGRRRLNSSSGSGSGSSGSSVSSPSWAGRLRGDRQQVVAAGTLSPPGPEEAKRKLRILQRELQNVQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSPSPCPFRSSSQPPGRVLVQGARSEERRTKSWGEQCPETSGTDSGRKGGPSLCSSQVKKGMPPLPGRAAPTGSEAQGPSAFVRMEKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITPKB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for ITPKB Antibody [PE]

• EC 2.7.1.127
• inositol 14,5-trisphosphate 3-kinase BIP3K
• inositol-trisphosphate 3-kinase B
• InsP 3-kinase B
• IP3 3-kinase B
• IP3-3KB
• IP3K B
• IP3KB
• IP3K-B
• PIG37
• proliferation-inducing protein 37

Background

ITPKB is encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITPKB