ISPD Recombinant Protein Antigen

Images

 
There are currently no images for ISPD Recombinant Protein Antigen (NBP2-58091PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ISPD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ISPD.

Source: E.coli

Amino Acid Sequence: IVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAEDQINSKLSKPEVVIIHDAVRPFVEEGVLLKVVTAAKEHG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ISPD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58091 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ISPD Recombinant Protein Antigen

  • 4-diphosphocytidyl-2C-methyl-D-erythritol synthase homolog
  • isoprenoid synthase domain containing
  • isoprenoid synthase domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81451
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC, IHC-P
NB600-1397
Species: Hu, Mu, Bv, Ca, Mk, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
H00005347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02269
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85734
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NB7276
Species: Ch
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-58091PEP
Species: Hu
Applications: AC

Publications for ISPD Recombinant Protein Antigen (NBP2-58091PEP) (0)

There are no publications for ISPD Recombinant Protein Antigen (NBP2-58091PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISPD Recombinant Protein Antigen (NBP2-58091PEP) (0)

There are no reviews for ISPD Recombinant Protein Antigen (NBP2-58091PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ISPD Recombinant Protein Antigen (NBP2-58091PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ISPD Products

Bioinformatics Tool for ISPD Recombinant Protein Antigen (NBP2-58091PEP)

Discover related pathways, diseases and genes to ISPD Recombinant Protein Antigen (NBP2-58091PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ISPD Recombinant Protein Antigen (NBP2-58091PEP)

Discover more about diseases related to ISPD Recombinant Protein Antigen (NBP2-58091PEP).
 

Pathways for ISPD Recombinant Protein Antigen (NBP2-58091PEP)

View related products by pathway.

PTMs for ISPD Recombinant Protein Antigen (NBP2-58091PEP)

Learn more about PTMs related to ISPD Recombinant Protein Antigen (NBP2-58091PEP).

Blogs on ISPD

There are no specific blogs for ISPD, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ISPD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ISPD
Novus 100% Guarantee