ISLR-2 Antibody

Images

 
Western Blot: ISLR2 Antibody [NBP1-91341] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ISLR-2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ISLR2. Peptide sequence PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISLR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ISLR2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ISLR-2 Antibody

  • immunoglobulin superfamily containing leucine-rich repeat 2
  • ISLR2
  • ISLR-2
  • KIAA1465
  • leucine-rich repeat domain and immunoglobulin domain-containing axon extension protein
  • LINX
  • UNQ1885/PRO4329

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF482
Species: Mu
Applications: WB, IHC
7815-NG/CF
Species: Rt
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91150
Species: Hu
Applications: IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready

Publications for ISLR-2 Antibody (NBP1-91341) (0)

There are no publications for ISLR-2 Antibody (NBP1-91341).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISLR-2 Antibody (NBP1-91341) (0)

There are no reviews for ISLR-2 Antibody (NBP1-91341). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ISLR-2 Antibody (NBP1-91341) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ISLR-2 Antibody (NBP1-91341)

Discover related pathways, diseases and genes to ISLR-2 Antibody (NBP1-91341). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ISLR-2 Antibody (NBP1-91341)

View related products by pathway.

Blogs on ISLR-2

There are no specific blogs for ISLR-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ISLR-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISLR2
Entrez
Uniprot