ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen

Images

 
There are currently no images for ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen (NBP2-55032PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ISG15 Activating Enzyme/UBE1L.

Source: E. coli

Amino Acid Sequence: EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBA7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55032.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen

  • D8
  • D8UBA1, ubiquitin-activating enzyme E1 homolog B
  • ISG15 Activating Enzyme/UBE1L
  • UBA1B
  • UBA7
  • UBA7, ubiquitin-activating enzyme E1
  • UBE1L
  • UBE2
  • UBE2MGC12713
  • Ubiquitin-activating enzyme 7
  • Ubiquitin-activating enzyme E1 homolog
  • ubiquitin-activating enzyme E1-like
  • ubiquitin-activating enzyme E1-related protein
  • ubiquitin-activating enzyme-2
  • ubiquitin-like modifier activating enzyme 7
  • ubiquitin-like modifier-activating enzyme 7

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme is a retinoid target that triggers promyelocytic leukemia (PML)/retinoic acid receptor alpha (RARalpha) degradation and apoptosis in acute promyelocytic leukemia, where it is involved in the conjugation of the ubiquitin-like interferon-stimulated gene 15 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
UL-553
Species: Hu
Applications: EnzAct
NBP1-05767
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56725
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
NBP1-04351
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1364
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
NBP3-35697
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-92556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
DIP100
Species: Hu
Applications: ELISA
NBP2-55032PEP
Species: Hu
Applications: AC

Publications for ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen (NBP2-55032PEP) (0)

There are no publications for ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen (NBP2-55032PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen (NBP2-55032PEP) (0)

There are no reviews for ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen (NBP2-55032PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen (NBP2-55032PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ISG15 Activating Enzyme/UBE1L Products

Blogs on ISG15 Activating Enzyme/UBE1L

There are no specific blogs for ISG15 Activating Enzyme/UBE1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBA7