Recombinant Human IRX3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IRX3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 182-285 of Human IRX3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI

Protein/Peptide Type
Partial Recombinant Protein
Gene
IRX3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IRX3 Protein

  • Homeodomain protein IRXB1
  • iroquois homeobox 3
  • Iroquois homeobox protein 3
  • iroquois-class homeodomain protein IRX-1
  • iroquois-class homeodomain protein IRX-3
  • IRX-1
  • IRXB1FLJ99187

Background

IRX3 - iroquois homeobox protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010265-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-83090
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00153572-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81581
Species: Hu
Applications: IHC, IHC-P
NBL1-12041
Species: Hu
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82554
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
AF475
Species: Mu
Applications: WB, IHC
H00006496-M04
Species: Hu
Applications: WB, ELISA
NB100-55393
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
AF2567
Species: Mu
Applications: WB, IHC
H00079191-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IRX3 Partial Recombinant Protein (H00079191-Q01) (0)

There are no publications for IRX3 Partial Recombinant Protein (H00079191-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRX3 Partial Recombinant Protein (H00079191-Q01) (0)

There are no reviews for IRX3 Partial Recombinant Protein (H00079191-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRX3 Partial Recombinant Protein (H00079191-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IRX3 Products

Bioinformatics Tool for IRX3 Partial Recombinant Protein (H00079191-Q01)

Discover related pathways, diseases and genes to IRX3 Partial Recombinant Protein (H00079191-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRX3 Partial Recombinant Protein (H00079191-Q01)

Discover more about diseases related to IRX3 Partial Recombinant Protein (H00079191-Q01).
 

Pathways for IRX3 Partial Recombinant Protein (H00079191-Q01)

View related products by pathway.

PTMs for IRX3 Partial Recombinant Protein (H00079191-Q01)

Learn more about PTMs related to IRX3 Partial Recombinant Protein (H00079191-Q01).

Blogs on IRX3

There are no specific blogs for IRX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FOXL2 Antibody
NB100-1277
IRX3 Antibody (1D7)
H00079191-M05
NKX6.1 Antibody
NBP1-49672

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IRX3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IRX3