Recombinant Human Intersectin 1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Intersectin 1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 588-675 of Human Intersectin 1

Source: Wheat Germ

Amino Acid Sequence: EVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ITSN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Intersectin 1 Protein

  • 11
  • intersectin 1 (SH3 domain protein)
  • intersectin short variant 12
  • intersectin-1
  • ITSN
  • SH3 domain protein-1A
  • SH3 domain-containing protein 1A
  • Src homology 3 domain-containing protein

Background

The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP1-71833
Species: Hu, Mu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP1-87561
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Intersectin 1 Partial Recombinant Protein (H00006453-Q01) (0)

There are no publications for Intersectin 1 Partial Recombinant Protein (H00006453-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Intersectin 1 Partial Recombinant Protein (H00006453-Q01) (0)

There are no reviews for Intersectin 1 Partial Recombinant Protein (H00006453-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Intersectin 1 Partial Recombinant Protein (H00006453-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Intersectin 1 Partial Recombinant Protein (H00006453-Q01)

Discover related pathways, diseases and genes to Intersectin 1 Partial Recombinant Protein (H00006453-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Intersectin 1 Partial Recombinant Protein (H00006453-Q01)

Discover more about diseases related to Intersectin 1 Partial Recombinant Protein (H00006453-Q01).
 

Pathways for Intersectin 1 Partial Recombinant Protein (H00006453-Q01)

View related products by pathway.

PTMs for Intersectin 1 Partial Recombinant Protein (H00006453-Q01)

Learn more about PTMs related to Intersectin 1 Partial Recombinant Protein (H00006453-Q01).

Blogs on Intersectin 1

There are no specific blogs for Intersectin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Intersectin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITSN1