Recombinant Human Interferon alpha 6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Interferon alpha 6 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 189 of Human IFNA6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
IFNA6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Interferon alpha 6 Protein

  • IFN-alpha-6
  • IFN-alphaK
  • Interferon alpha-54
  • interferon alpha-6
  • Interferon alpha-K
  • interferon, alpha 6
  • LeIF K

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003451-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Interferon alpha 6 Recombinant Protein (H00003443-P01) (0)

There are no publications for Interferon alpha 6 Recombinant Protein (H00003443-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Interferon alpha 6 Recombinant Protein (H00003443-P01) (0)

There are no reviews for Interferon alpha 6 Recombinant Protein (H00003443-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Interferon alpha 6 Recombinant Protein (H00003443-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Interferon alpha 6 Products

Bioinformatics Tool for Interferon alpha 6 Recombinant Protein (H00003443-P01)

Discover related pathways, diseases and genes to Interferon alpha 6 Recombinant Protein (H00003443-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Interferon alpha 6 Recombinant Protein (H00003443-P01)

Discover more about diseases related to Interferon alpha 6 Recombinant Protein (H00003443-P01).
 

Pathways for Interferon alpha 6 Recombinant Protein (H00003443-P01)

View related products by pathway.

PTMs for Interferon alpha 6 Recombinant Protein (H00003443-P01)

Learn more about PTMs related to Interferon alpha 6 Recombinant Protein (H00003443-P01).

Blogs on Interferon alpha 6

There are no specific blogs for Interferon alpha 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Interferon alpha 6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA6