Recombinant Human IFN-alpha K GST (N-Term) Protein

Images

 
Recombinant Human IFN-alpha K GST (N-Term) Protein [H00003443-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related IFN-alpha K Peptides and Proteins

Order Details


    • Catalog Number
      H00003443-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human IFN-alpha K GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 189 of Human IFN-alpha K full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
IFNA6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
48.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IFN-alpha K GST (N-Term) Protein

  • IFNA6
  • IFN-alpha 6
  • IFNalpha K
  • IFN-alpha K
  • IFN-kappa
  • interferon kappa
  • interferon, kappa
  • RP11-27J8.1
  • UNQ6124/PRO20084

Background

Interferons (IFN) are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors (1). There are more than a dozen closely related IFN alpha subtypes found in both the human and mouse genome, each sharing about 80% amino acid (aa) sequence homology (2, 3). Mature mouse IFNA6 consists of 166 aa and shares 60% aa identity with human IFNA6. The type I IFNs binds to the interferon alpha receptor (IFNAR) which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit) (4, 5). Individual IFN alpha subtypes are known to display unique efficacies to viral protection, with IFNA6 displaying the superior efficacy controlling influenza virus infection and disease (6). Treatment with IFNA6 DNA 2 weeks post-MCMV infection proved effective at inhibiting the development of chronic autoimmune myocarditis. IFNA6 is also able to reduce chronic cardiac inflammation. These findings suggest that immunomodulation of both antiviral and autoimmune responses by IFN DNA immunization may be an avenue for improved viral immunotherapy (7, 8).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
8499-IF
Species: Hu
Applications: BA
H00003447-M03
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP3-41059
Species: Hu
Applications: IHC,  IHC-P, WB
11150-1
Species: Hu
Applications: BA
DY4307-05
Species: Hu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-06290
Species: Hu
Applications: IHC,  IHC-P
DCX900
Species: Hu
Applications: ELISA
MEP00B
Species: Mu
Applications: ELISA
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1207
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB

Publications for IFN-alpha K Full Length Recombinant Protein (H00003443-P01) (0)

There are no publications for IFN-alpha K Full Length Recombinant Protein (H00003443-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha K Full Length Recombinant Protein (H00003443-P01) (0)

There are no reviews for IFN-alpha K Full Length Recombinant Protein (H00003443-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-alpha K Full Length Recombinant Protein (H00003443-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFN-alpha K Products

Blogs on IFN-alpha K

There are no specific blogs for IFN-alpha K, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IFN-alpha K GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA6