Integrin alpha 9 Antibody (3E4.)

Images

 
Western Blot: Integrin alpha 9 Antibody (3E4) [H00003680-M01] - ITGA9 monoclonal antibody (M01), clone 3E4. Analysis of ITGA9 expression in HepG2.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E4.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin alpha 9 Antibody (3E4.) Summary

Immunogen
ITGA9 (NP_002198 785 a.a. - 886 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGR
Specificity
ITGA9 - integrin, alpha 9
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGA9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00003680-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin alpha 9 Antibody (3E4.)

  • ALPHA-RLC
  • Integrin alpha 9
  • integrin alpha-9
  • Integrin alpha-RLC
  • integrin, alpha 9
  • ITGA4L
  • ITGA9
  • RLC
  • RLC-alpha

Background

This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain, forms an integrin that is a receptor for VCAM1, cytotactin and osteopontin. Expression of this gene has been found to be upregulated in small cell lung cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
H00085366-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-56552
Species: Hu
Applications: WB
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003680-M01
Species: Hu
Applications: WB, ELISA

Publications for Integrin alpha 9 Antibody (H00003680-M01)(4)

Reviews for Integrin alpha 9 Antibody (H00003680-M01) (0)

There are no reviews for Integrin alpha 9 Antibody (H00003680-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 9 Antibody (H00003680-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 9 Products

Bioinformatics Tool for Integrin alpha 9 Antibody (H00003680-M01)

Discover related pathways, diseases and genes to Integrin alpha 9 Antibody (H00003680-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 9 Antibody (H00003680-M01)

Discover more about diseases related to Integrin alpha 9 Antibody (H00003680-M01).
 

Pathways for Integrin alpha 9 Antibody (H00003680-M01)

View related products by pathway.

PTMs for Integrin alpha 9 Antibody (H00003680-M01)

Learn more about PTMs related to Integrin alpha 9 Antibody (H00003680-M01).

Blogs on Integrin alpha 9

There are no specific blogs for Integrin alpha 9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 9 Antibody (3E4.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA9
Entrez
OMIM
Uniprot