Integrin alpha 7 Antibody

Images

 
Immunocytochemistry: Integrin alpha 7 Antibody [NBP1-86118] - Blue (Dapi), Red (Integrin alpha 7), Green (skeletal muscle Myosin). Mononucleated cells containing satellite cells and fibroblasts were isolated from bovine ...read more
Immunohistochemistry-Paraffin: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human heart muscle shows cytoplasmic and membranous positivity in myocytes.
Immunocytochemistry/ Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Product Details

Summary
Reactivity Hu, Bv, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCE
Specificity
Specificity of human Integrin alpha 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Integrin alpha 7 Protein (NBP1-86118PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-86118 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 7 Antibody

  • FLJ25220
  • integrin alpha 7 chain
  • Integrin alpha 7
  • integrin alpha-7
  • integrin, alpha 7
  • ITGA7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86118
Species: Hu, Bv
Applications: ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP2-55584
Species: Hu
Applications: ICC/IF
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF4817
Species: Mu
Applications: WB
NBP1-33084
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-84576
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86152
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55409
Species: Hu
Applications: WB, ICC/IF

Publications for Integrin alpha 7 Antibody (NBP1-86118) (0)

There are no publications for Integrin alpha 7 Antibody (NBP1-86118).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Integrin alpha 7 Antibody (NBP1-86118) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Bovine.

Reviews using NBP1-86118:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Bovine
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Integrin alpha 7 NBP1-86118
Enlarge
reviewed by:
Anonymous
ICC Bovine 03/20/2018
View

Summary

ApplicationImmunocytochemistry
Sample Testedskeletal muscle derived cells
SpeciesBovine
LotA83179

Comments

CommentsMononucleated cells containing satellite cells and fibroblasts were isolated from bovine skeletal muscle tissue and induced for myogenic differentiation. Cells were fixed in methanol and stained using anti-myosin antibody and anti-Integrin a7 (#NBP1-86118) antibody. Corresponding secondary antibodies were used to visualize the result. Strong integrin a7 signal was observed in myotubes. But some weaker signals were also observed in fibroblasts which are known to be negative for it.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Integrin alpha 7 Antibody (NBP1-86118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 7 Products

Bioinformatics Tool for Integrin alpha 7 Antibody (NBP1-86118)

Discover related pathways, diseases and genes to Integrin alpha 7 Antibody (NBP1-86118). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 7 Antibody (NBP1-86118)

Discover more about diseases related to Integrin alpha 7 Antibody (NBP1-86118).
 

Pathways for Integrin alpha 7 Antibody (NBP1-86118)

View related products by pathway.

PTMs for Integrin alpha 7 Antibody (NBP1-86118)

Learn more about PTMs related to Integrin alpha 7 Antibody (NBP1-86118).

Blogs on Integrin alpha 7

There are no specific blogs for Integrin alpha 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
03/20/2018
Application: ICC
Species: Bovine

Bioinformatics

Gene Symbol ITGA7
Entrez