![Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Blue (Dapi), Red (Integrin alpha 7), Green (skeletal muscle Myosin). Mononucleated cells containing satellite cells and fibroblasts were isolated from bovine skeletal muscle tissue and induced for myogenic differentiation. Cells were fixed in methanol and stained using anti-myosin antibody and anti-Integrin a7 (#NBP1-86118) antibody. Corresponding secondary antibodies were used to visualize the result. Strong integrin a7 signal was observed in myotubes. But some weaker signals were also observed in fibroblasts which are known to be negative for it. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize2/Integrin-alpha-7-Antibody-Immunocytochemistry-NBP1-86118-img0008.jpg "Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Blue (Dapi), Red (Integrin alpha 7), Green (skeletal muscle Myosin). Mononucleated cells containing satellite cells and fibroblasts were isolated from bovine skeletal muscle tissue and induced for myogenic differentiation. Cells were fixed in methanol and stained using anti-myosin antibody and anti-Integrin a7 (#NBP1-86118) antibody. Corresponding secondary antibodies were used to visualize the result. Strong integrin a7 signal was observed in myotubes. But some weaker signals were also observed in fibroblasts which are known to be negative for it. Image submitted by a verified customer review.")
| Reactivity | Hu, Mu, Bv, RtSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCE |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ITGA7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Integrin alpha 7 antibody validated for ICC/IF from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Flow-Cytometry-NB100-524-img0014.jpg)
![Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Flow-Cytometry-NB100-524-img0015.jpg)
![Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
![Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Protein-Array-NBP2-79843-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Immunocytochemistry-Immunofluorescence-NBP2-79843-img0002.jpg)
![Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Western-Blot-NBP2-79843-img0003.jpg)
![Western Blot: FKTN Antibody (7J5N6) [NBP3-15472] - Western blot analysis of extracts of various cell lines, using FKTN antibody (NBP3-15472) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.](http://images.novusbio.com/images2/FKTN-Antibody-(7J5N6)-Western-Blot-NBP3-15472-img0002.jpg)
![Immunohistochemistry-Paraffin: FKTN Antibody (7J5N6) [NBP3-15472] - Immunohistochemistry of paraffin-embedded human colon using FKTN Rabbit mAb (NBP3-15472) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/images2/FKTN-Antibody-(7J5N6)-Immunohistochemistry-Paraffin-NBP3-15472-img0001.jpg)
![Western Blot: FKRP Antibody [NBP3-04945] - Analysis of extracts of various cell lines, using FKRP antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit](http://images.novusbio.com/images2/FKRP-Antibody-Western-Blot-NBP3-04945-img0001.jpg)
![Flow Cytometry: EMMPRIN/CD147 Antibody (OX-47) [NB100-64848] - Rat Splenocytes were stained with EMMPRIN/CD147 (OX-47) antibody NB100-64848 (blue) and a matched isotype control NBP2-27287 (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature. The antibodies were directly conjugated to Alexa Fluor 488.](http://images.novusbio.com/images2/EMMPRIN-CD147-Antibody-(OX-47)-Flow-Cytometry-NB100-64848-img0001.jpg)
![Immunohistochemistry-Paraffin: EMMPRIN/CD147 Antibody (OX-47) [NB100-64848] - Analysis of FFPE tissue section of rat kidney using 1:100 dilution of CD147 antibody (clone OX-47). The staining was detected using HRP-labelled secondary antibody and DAB reagent which followed counterstaining of sections with hematoxylin. This antibody generated primarily a membrane staining with some cytoplasmic signal in the cuboidal epithelial cells of various tubules.](http://images.novusbio.com/images2/EMMPRIN-CD147-Antibody-(OX-47)-Immunohistochemistry-Paraffin-NB100-64848-img0002.jpg)
![Immunohistochemistry-Paraffin: POMT1 Antibody [NBP3-12487] - 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40x magnification.](http://images.novusbio.com/images2/POMT1-Antibody-Immunohistochemistry-Paraffin-NBP3-12487-img0001.jpg)
![Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.](http://images.novusbio.com/images2/IFN-alpha-1-Antibody-Western-Blot-NBP2-75930-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/IFN-alpha-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-75930-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/IFN-alpha-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-75930-img0003.jpg)
![Western Blot: POMT2 Antibody [NBP3-12334] - 1. Rat cortex, 2. Rat heart, 3. C2C12 cells. Apparent MW is 85-90 KDa. 1:250 Dilution DilObuffer.](http://images.novusbio.com/images2/POMT2-Antibody-Western-Blot-NBP3-12334-img0001.jpg)
![Immunohistochemistry-Paraffin: POMT2 Antibody [NBP3-12334] - Rat Testis. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnification.](http://images.novusbio.com/images2/POMT2-Antibody-Immunohistochemistry-Paraffin-NBP3-12334-img0002.jpg)
![Immunohistochemistry-Paraffin: POMT2 Antibody [NBP3-12334] - Rat kidney. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnification.](http://images.novusbio.com/images2/POMT2-Antibody-Immunohistochemistry-Paraffin-NBP3-12334-img0004.jpg)
![Western Blot: QSOX1/Quiescin Q6 Antibody [NBP2-81797] - Analysis of QSOX1/Quiescin Q6 in EL4 cell lysate with QSOX1/Quiescin Q6 antibody at (A) 1 and (B) 2 ug/ml.](http://images.novusbio.com/images2/QSOX1-Quiescin-Q6-Antibody-Western-Blot-NBP2-81797-img0001.jpg)
![Immunohistochemistry: QSOX1/Quiescin Q6 Antibody [NBP2-81797] - Immunohistochemistry of QSOX1/Quiescin Q6 in human spleen tissue with QSOX1/Quiescin Q6 antibody at 5 ug/mL.](http://images.novusbio.com/images2/QSOX1-Quiescin-Q6-Antibody-Immunohistochemistry-NBP2-81797-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: QSOX1/Quiescin Q6 Antibody [NBP2-81797] - Immunofluorescence of QSOX1/Quiescin Q6 in human spleen tissue with QSOX1/Quiescin Q6 antibody at 20 ug/ml.](http://images.novusbio.com/images2/QSOX1-Quiescin-Q6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-81797-img0003.jpg)
| Publication using NBP1-86118 | Applications | Species |
|---|---|---|
| Gonzalez Porras MA, Stojkova K, Vaicik MK et al. Integrins and extracellular matrix proteins modulate adipocyte thermogenic capacity Scientific reports Mar 8 2021 [PMID: 33686208] (IHC, Mouse) | IHC | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
ICC | Bovine | 03/20/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for Integrin alpha 7 Antibody (NBP1-86118)Discover more about diseases related to Integrin alpha 7 Antibody (NBP1-86118).
| Pathways for Integrin alpha 7 Antibody (NBP1-86118)View related products by pathway.
|
PTMs for Integrin alpha 7 Antibody (NBP1-86118)Learn more about PTMs related to Integrin alpha 7 Antibody (NBP1-86118).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ITGA7 |
![Immunohistochemistry-Paraffin: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human heart muscle shows cytoplasmic and membranous positivity in myocytes.](http://images.novusbio.com/fullsize2/Integrin-alpha-7-Antibody-Immunohistochemistry-Paraffin-NBP1-86118-img0007.jpg "Immunohistochemistry-Paraffin: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human heart muscle shows cytoplasmic and membranous positivity in myocytes.")
![Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Integrin-alpha-7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86118-img0006.jpg "Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Blue (Dapi), Red (Integrin alpha 7), Green (skeletal muscle Myosin). Mononucleated cells containing satellite cells and fibroblasts were isolated from bovine skeletal muscle tissue and induced for myogenic differentiation. Cells were fixed in methanol and stained using anti-myosin antibody and anti-Integrin a7 (#NBP1-86118) antibody. Corresponding secondary antibodies were used to visualize the result. Strong integrin a7 signal was observed in myotubes. But some weaker signals were also observed in fibroblasts which are known to be negative for it. Image submitted by a verified customer review.](http://images.novusbio.com/images2/Integrin-alpha-7-Antibody-Immunocytochemistry-NBP1-86118-img0008.jpg)
![Immunohistochemistry-Paraffin: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human heart muscle shows cytoplasmic and membranous positivity in myocytes.](http://images.novusbio.com/images2/Integrin-alpha-7-Antibody-Immunohistochemistry-Paraffin-NBP1-86118-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/Integrin-alpha-7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86118-img0006.jpg)
![Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.](http://images.novusbio.com/images2/Dystrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-89953-img0007.jpg)
![Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.](http://images.novusbio.com/images2/Dystrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-89953-img0008.jpg)
![Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human tonsil shows no positivity as expected.](http://images.novusbio.com/images2/Dystrophin-Antibody-Immunohistochemistry-Paraffin-NBP1-89953-img0009.jpg)
![Western Blot: HDAC9 Antibody [NBP2-03993] - Analysis of HDAC-9 in human HeLa cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) and mouse RAW cell lysate using this antibody. 0 ug/ml, 1.0 ug/ml and 0.5 ug/ml respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/HDAC9-Antibody-Western-Blot-NBP2-03993-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
