Integrin alpha 7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Blue (Dapi), Red (Integrin alpha 7), Green (skeletal muscle Myosin). Mononucleated cells containing satellite cells and fibroblasts were ...read more
Immunohistochemistry-Paraffin: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human heart muscle shows cytoplasmic and membranous positivity in myocytes.
Immunocytochemistry/ Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, Bv, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCE
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Integrin alpha 7 antibody validated for ICC/IF from a verified customer review.
Control Peptide
Integrin alpha 7 Protein (NBP1-86118PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-86118 in the following applications:

Publications
Read Publication using
NBP1-86118 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33686208). Bovine reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 7 Antibody

  • FLJ25220
  • integrin alpha 7 chain
  • Integrin alpha 7
  • integrin alpha-7
  • integrin, alpha 7
  • ITGA7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-86118
Species: Bv, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP3-15472
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-04945
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DVC00
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
AF4817
Species: Mu
Applications: WB
7414-GT
Species: Hu
Applications: EnzAct
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-12334
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-81797
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-86118
Species: Hu, Mu, Bv, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Integrin alpha 7 Antibody (NBP1-86118)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for Integrin alpha 7 Antibody (NBP1-86118) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Bovine.

Reviews using NBP1-86118:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Bovine
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Integrin alpha 7 NBP1-86118
Enlarge
4
reviewed by:
Verified Customer
ICC Bovine 03/20/2018
View

Summary

ApplicationImmunocytochemistry
Sample Testedskeletal muscle derived cells
SpeciesBovine
LotA83179

Comments

CommentsMononucleated cells containing satellite cells and fibroblasts were isolated from bovine skeletal muscle tissue and induced for myogenic differentiation. Cells were fixed in methanol and stained using anti-myosin antibody and anti-Integrin a7 (#NBP1-86118) antibody. Corresponding secondary antibodies were used to visualize the result. Strong integrin a7 signal was observed in myotubes. But some weaker signals were also observed in fibroblasts which are known to be negative for it.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Integrin alpha 7 Antibody (NBP1-86118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 7 Products

Bioinformatics Tool for Integrin alpha 7 Antibody (NBP1-86118)

Discover related pathways, diseases and genes to Integrin alpha 7 Antibody (NBP1-86118). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 7 Antibody (NBP1-86118)

Discover more about diseases related to Integrin alpha 7 Antibody (NBP1-86118).
 

Pathways for Integrin alpha 7 Antibody (NBP1-86118)

View related products by pathway.

PTMs for Integrin alpha 7 Antibody (NBP1-86118)

Learn more about PTMs related to Integrin alpha 7 Antibody (NBP1-86118).

Blogs on Integrin alpha 7

There are no specific blogs for Integrin alpha 7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
03/20/2018
Application: ICC
Species: Bovine

Bioinformatics

Gene Symbol ITGA7