Integrin alpha 7 Antibody (8G2)

Images

 
Western Blot: Integrin alpha 7 Antibody (8G2) [H00003679-M01] - ITGA7 monoclonal antibody (M01), clone 8G2 Analysis of ITGA7 expression in Jurkat.
Sandwich ELISA: Integrin alpha 7 Antibody (8G2) [H00003679-M01] - Detection limit for recombinant GST tagged ITGA7 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
8G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin alpha 7 Antibody (8G2) Summary

Immunogen
ITGA7 (NP_002197, 478 a.a. ~ 577 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ
Specificity
ITGA7 - integrin, alpha 7
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGA7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA 1:100-1:2000
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using
H00003679-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin alpha 7 Antibody (8G2)

  • FLJ25220
  • integrin alpha 7 chain
  • Integrin alpha 7
  • integrin alpha-7
  • integrin, alpha 7
  • ITGA7

Background

ITGA7 encodes integrin alpha chain 7. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 7 undergoes post-translational cleavage within the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that binds to the extracellular matrix protein laminin-1. Alpha 7 beta 1 is the major integrin complex expressed in differentiated muscle cells. Splice variants of alpha 7 that differ in both the extracellular and cytoplasmic domains exist in the mouse; however, to date only a single human transcript type has been isolated: it contains extracellular and cytoplasmic domains corresponding to the mouse X2 and B variants, respectively. A unique extracellular splice variant has been identified in human, although it clearly represents a minor species and its biological significance is unclear.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-86118
Species: Hu, Bv
Applications: ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP3-04945
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
6507-IL/CF
Species: Hu
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NB100-64848
Species: Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-93413
Species: Hu, Mu
Applications: WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52680
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, B/N, CyTOF-ready, IF
NBP1-86152
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-81797
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003679-M01
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA

Publications for Integrin alpha 7 Antibody (H00003679-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Integrin alpha 7 Antibody (H00003679-M01) (0)

There are no reviews for Integrin alpha 7 Antibody (H00003679-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 7 Antibody (H00003679-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Integrin alpha 7 Products

Bioinformatics Tool for Integrin alpha 7 Antibody (H00003679-M01)

Discover related pathways, diseases and genes to Integrin alpha 7 Antibody (H00003679-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 7 Antibody (H00003679-M01)

Discover more about diseases related to Integrin alpha 7 Antibody (H00003679-M01).
 

Pathways for Integrin alpha 7 Antibody (H00003679-M01)

View related products by pathway.

PTMs for Integrin alpha 7 Antibody (H00003679-M01)

Learn more about PTMs related to Integrin alpha 7 Antibody (H00003679-M01).
 

Research Areas for Integrin alpha 7 Antibody (H00003679-M01)

Find related products by research area.

Blogs on Integrin alpha 7

There are no specific blogs for Integrin alpha 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 7 Antibody (8G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA7
Entrez
OMIM
Uniprot