Integrin alpha 2/CD49b Antibody (2B6)

Western Blot: Integrin alpha 2/CD49b Antibody (2B6) [H00003673-M01] - ITGA2 monoclonal antibody (M01), clone 2B6 Analysis of ITGA2 expression in A-431.

Immunocytochemistry/Immunofluorescence: Integrin alpha 2/CD49b Antibody (2B6) [H00003673-M01] - Analysis of monoclonal antibody to ITGA2 on A-431 cell. Antibody concentration 10 ug/ml.

ELISA: Integrin alpha 2/CD49b Antibody (2B6) [H00003673-M01] - Detection limit for recombinant GST tagged ITGA2 is approximately 0.3ng/ml as a capture antibody.

Product Discontinued

Integrin alpha 2/CD49b Antibody (2B6) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
• Marker: Plasma Membrane Marker
• Specificity: ITGA2 - integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITGA2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin alpha 2/CD49b Antibody (2B6)

• alpha-2 subunit
• CD49b antigen
• CD49b
• Integrin alpha 2
• integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
• ITGA2
• VLA 2
• VLA-2 alpha

Background

This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Integrin alpha 2/CD49b Antibody (H00003673-M01)(1)

Publication using H00003673-M01

• Haglund L, Tillgren V, Addis L et al. Identification and Characterization of the Integrin {alpha}2{beta}1 Binding Motif in Chondroadherin Mediating Cell Attachment. J Biol Chem. 2010-12-02 [PMID: 21127050]

Bioinformatics

• Gene Symbol: ITGA2
• Entrez:
  • 3673(Human)
• OMIM:
  • 192974(Human)
• Uniprot:
  • NP_002194()