INPP5A Antibody - BSA Free

Analysis in human endometrium and tonsil tissues using NBP1-89361 antibody. Corresponding INPP5A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells, as well as very weak positivity in a subset of non-germinal center cells.

Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human heart muscle shows moderate cytoplasmic positivity, as well as strong immunoreactivity in intercalated discs of cardiomyocytes.

Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and INPP5A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

INPP5A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit INPP5A Antibody - BSA Free (NBP1-89361) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFL
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INPP5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  INPP5A Protein (NBP1-89361PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for INPP5A Antibody - BSA Free

• 43 kDa inositol polyphosphate 5-phophatase
• CTCL tumor antigen HD-CL-02,5PTASE
• DKFZp434A1721
• EC 3.1.3.56
• inositol polyphosphate-5-phosphatase, 40kD
• inositol polyphosphate-5-phosphatase, 40kDa
• inositol trisphosphate-5-phosphatase, 40kD
• InsP3 5-phosphatase
• MGC116947,5PTase
• MGC116949
• type I inositol-14,5-trisphosphate 5-phophatase
• type I inositol-14,5-trisphosphate 5-phosphatase

Background

INPP5A is a gene which codes for a protein that functions as a major isoenzyme that hydrolyzes the calcium-mobilizing second messenger Ins(1,4,5)P3 in a signal-terminating reaction and is comprised of 412 amino acids, with a mass of approximately 48 kDa. Studies are being conducted in several diseases and disorders relating to this gene including oculocerebrorenal syndrome, cutaneous T cell lymphoma, squamous cell carcinoma, Fanconi syndrome, schizophrenia, carcinoma, and olivopontocerebellar atrophy. INPP5A has also been shown to have interactions with PLEK, YWHAZ, GRB2, INPP1, and IPMK in pathways such as the inositol phosphate metabolism pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INPP5A