INO80B Antibody

Western Blot: INO80B Antibody [NBP1-98506] - Mouse Liver Lysate 1.0ug/ml, Gel Concentration: 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

INO80B Antibody Summary

• Immunogen: The immunogen for this antibody is Ino80b - C-terminal region. Peptide sequence SPTLPLPVGGGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIER. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INO80B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for INO80B Antibody

• HMGIYL4
• IES2 homolog
• IES2
• INO80 complex subunit B
• PAP-1 binding protein
• PAP-1BP
• PAPA1
• zinc finger, HIT type 4

Background

Ino80b is a proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INO80B
• Uniprot:
  • NP_076036(Mouse)