INO80B Antibody

Images

 
Western Blot: INO80B Antibody [NBP1-98506] - Mouse Liver Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

INO80B Antibody Summary

Immunogen
The immunogen for this antibody is Ino80b - C-terminal region. Peptide sequence SPTLPLPVGGGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIER.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INO80B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for INO80B Antibody

  • HMGIYL4
  • IES2 homolog
  • IES2
  • INO80 complex subunit B
  • PAP-1 binding protein
  • PAP-1BP
  • PAPA1
  • zinc finger, HIT type 4

Background

Ino80b is a proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009541-M01
Species: Hu
Applications: WB, ELISA
AF4079
Species: Hu
Applications: WB, ICC
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-84423
Species: Hu
Applications: IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88081
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56397
Species: Hu
Applications: WB
AF674
Species: Hu
Applications: WB, Simple Western, Neut
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-19120
Species: Hu, Mu
Applications: WB, IHC-P, IP

Publications for INO80B Antibody (NBP1-98506) (0)

There are no publications for INO80B Antibody (NBP1-98506).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INO80B Antibody (NBP1-98506) (0)

There are no reviews for INO80B Antibody (NBP1-98506). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INO80B Antibody (NBP1-98506) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INO80B Products

INO80B NBP1-98506

Bioinformatics Tool for INO80B Antibody (NBP1-98506)

Discover related pathways, diseases and genes to INO80B Antibody (NBP1-98506). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INO80B Antibody (NBP1-98506)

Discover more about diseases related to INO80B Antibody (NBP1-98506).
 

Pathways for INO80B Antibody (NBP1-98506)

View related products by pathway.

PTMs for INO80B Antibody (NBP1-98506)

Learn more about PTMs related to INO80B Antibody (NBP1-98506).

Blogs on INO80B

There are no specific blogs for INO80B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INO80B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INO80B
Uniprot