Importin alpha 5/KPNA1/SRP1 Antibody

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [H00003836-B01P] - Analysis of KPNA1 expression in HeLa.

Immunocytochemistry/Immunofluorescence: Importin alpha 5/KPNA1/SRP1 Antibody [H00003836-B01P] - Analysis of purified antibody to KPNA1 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [H00003836-B01P] - Analysis of KPNA1 expression in transfected 293T cell line by KPNA1 polyclonal antibody. Lane 1: KPNA1 transfected lysate(59.18 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Importin alpha 5/KPNA1/SRP1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: KPNA1 (NP_002255.2, 1 a.a. - 538 a.a.) full-length human protein. MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
• Specificity: Reacts with karyopherin alpha 1 (importin alpha 5).
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: KPNA1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Importin alpha 5/KPNA1/SRP1 Antibody

• Importin alpha 5
• importin subunit alpha-1
• importin-alpha-S1
• IPOA5
• karyopherin alpha 1 (importin alpha 5)
• Karyopherin subunit alpha-1
• KPNA1
• NPI-1
• NPI-1SRP1importin alpha 5
• Nucleoprotein interactor 1
• RCH2
• RCH2RAG cohort protein 2
• recombination activating gene cohort 2
• SRP1
• SRP1-beta

Background

Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination. Two transcript variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KPNA1
• Entrez:
  • 3836(Human)
• Uniprot:
  • NP_002255.2(Human)