Importin alpha 5/KPNA1/SRP1 Antibody

Images

 
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [H00003836-A02] - Analysis of KPNA1 expression in PC-12.
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [H00003836-A02] - Analysis of KPNA1 expression in NIH/3T3 (Cat # L018V1).
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [H00003836-A02] - Analysis of KPNA1 expression in Raw 264.7.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Importin alpha 5/KPNA1/SRP1 Antibody Summary

Immunogen
KPNA1 (AAH02374.1, 1 a.a. - 538 a.a.) full-length recombinant protein with GST tag. MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Specificity
KPNA1 - karyopherin alpha 1 (importin alpha 5)
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
KPNA1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00003836-A02.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Importin alpha 5/KPNA1/SRP1 Antibody

  • Importin alpha 5
  • importin subunit alpha-1
  • importin-alpha-S1
  • IPOA5
  • karyopherin alpha 1 (importin alpha 5)
  • Karyopherin subunit alpha-1
  • KPNA1
  • NPI-1
  • NPI-1SRP1importin alpha 5
  • Nucleoprotein interactor 1
  • RCH2
  • RCH2RAG cohort protein 2
  • recombination activating gene cohort 2
  • SRP1
  • SRP1-beta

Background

Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP1-31260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-07799
Species: Hu
NBP1-74190
Species: Mu
Applications: WB, ChIP
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-81650
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83762
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003836-A02
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02)(1)

Reviews for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02) (0)

There are no reviews for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Importin alpha 5/KPNA1/SRP1 Products

Bioinformatics Tool for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02)

Discover related pathways, diseases and genes to Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02)

Discover more about diseases related to Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02).
 

Pathways for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02)

View related products by pathway.

PTMs for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02)

Learn more about PTMs related to Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-A02).

Blogs on Importin alpha 5/KPNA1/SRP1

There are no specific blogs for Importin alpha 5/KPNA1/SRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Importin alpha 5/KPNA1/SRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA1
Entrez
OMIM
Uniprot