Importin alpha 2/KPNA2 Recombinant Protein Antigen

Images

 
There are currently no images for Importin alpha 2/KPNA2 Protein (NBP2-38482PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Importin alpha 2/KPNA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KPNA2.

Source: E. coli

Amino Acid Sequence: AKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KPNA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38482.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Importin alpha 2/KPNA2 Recombinant Protein Antigen

  • Importin alpha 1
  • Importin alpha 2
  • importin-alpha-P1
  • IPOA1
  • karyopherin alpha 2 (RAG cohort 1, importin alpha 1)
  • Karyopherin subunit alpha-2
  • KPNA2
  • Pendulin
  • QIP2
  • QIP2importin alpha 2
  • RAG cohort 1
  • RAG cohort protein 1
  • RCH1
  • RCH1importin subunit alpha-2
  • SRP1
  • SRP1alpha
  • SRP1-alpha

Background

The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003836-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP1-31260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-74190
Species: Mu
Applications: ChIP, WB
NB100-81650
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB8209
Species: Hu, Mu, Rt
Applications: ICC, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-86960
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-43666
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85638
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-47281
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00010691-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
MAB5745
Species: Hu
Applications: IHC, WB
NBP2-38482PEP
Species: Hu
Applications: AC

Publications for Importin alpha 2/KPNA2 Protein (NBP2-38482PEP) (0)

There are no publications for Importin alpha 2/KPNA2 Protein (NBP2-38482PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin alpha 2/KPNA2 Protein (NBP2-38482PEP) (0)

There are no reviews for Importin alpha 2/KPNA2 Protein (NBP2-38482PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Importin alpha 2/KPNA2 Protein (NBP2-38482PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Importin alpha 2/KPNA2 Products

Research Areas for Importin alpha 2/KPNA2 Protein (NBP2-38482PEP)

Find related products by research area.

Blogs on Importin alpha 2/KPNA2

There are no specific blogs for Importin alpha 2/KPNA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Importin alpha 2/KPNA2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA2