Recombinant Human Importin-7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Importin-7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 950-1038 of Human IPO7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
IPO7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Importin-7 Protein

  • FLJ14581
  • Imp7MGC138673
  • importin 7
  • RAN binding protein 7
  • Ran-binding protein 7
  • RanBP7
  • RANBP7importin-7

Background

The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. Similar to importin-beta, this protein prevents the activation of Ran's GTPase by RanGAP1 and inhibits nucleotide exchange on RanGTP, and also binds directly to nuclear pore complexes where it competes for binding sites with importin-beta and transportin. This protein has a Ran-dependent transport cycle and it can cross the nuclear envelope rapidly and in both directions. At least four importin beta-like transport receptors, namely importin beta itself, transportin, RanBP5 and RanBP7, directly bind and import ribosomal proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-24751
Species: Hu, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00003843-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP1-92626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
355-BM/CF
Species: Hu, Mu, Rt
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB400-151
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA

Publications for Importin-7 Partial Recombinant Protein (H00010527-Q01) (0)

There are no publications for Importin-7 Partial Recombinant Protein (H00010527-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin-7 Partial Recombinant Protein (H00010527-Q01) (0)

There are no reviews for Importin-7 Partial Recombinant Protein (H00010527-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Importin-7 Partial Recombinant Protein (H00010527-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Importin-7 Products

Bioinformatics Tool for Importin-7 Partial Recombinant Protein (H00010527-Q01)

Discover related pathways, diseases and genes to Importin-7 Partial Recombinant Protein (H00010527-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin-7 Partial Recombinant Protein (H00010527-Q01)

Discover more about diseases related to Importin-7 Partial Recombinant Protein (H00010527-Q01).
 

Pathways for Importin-7 Partial Recombinant Protein (H00010527-Q01)

View related products by pathway.

PTMs for Importin-7 Partial Recombinant Protein (H00010527-Q01)

Learn more about PTMs related to Importin-7 Partial Recombinant Protein (H00010527-Q01).

Blogs on Importin-7

There are no specific blogs for Importin-7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Importin-7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IPO7