Recombinant Human Importin-7 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Importin-7 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 950-1038 of Human Importin-7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
IPO7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Importin-7 GST (N-Term) Protein

  • FLJ14581
  • Imp7MGC138673
  • importin 7
  • RAN binding protein 7
  • Ran-binding protein 7
  • RanBP7
  • RANBP7importin-7

Background

The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. Similar to importin-beta, this protein prevents the activation of Ran's GTPase by RanGAP1 and inhibits nucleotide exchange on RanGTP, and also binds directly to nuclear pore complexes where it competes for binding sites with importin-beta and transportin. This protein has a Ran-dependent transport cycle and it can cross the nuclear envelope rapidly and in both directions. At least four importin beta-like transport receptors, namely importin beta itself, transportin, RanBP5 and RanBP7, directly bind and import ribosomal proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24751
Species: Hu, Pm
Applications: ICC/IF, IP, Simple Western, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00003843-M01
Species: Ca, Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00150094-D01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
NB100-93304
Species: ChHa, Hu
Applications: IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP1-84290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00010527-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Importin-7 Partial Recombinant Protein (H00010527-Q01) (0)

There are no publications for Importin-7 Partial Recombinant Protein (H00010527-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin-7 Partial Recombinant Protein (H00010527-Q01) (0)

There are no reviews for Importin-7 Partial Recombinant Protein (H00010527-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Importin-7 Partial Recombinant Protein (H00010527-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Importin-7 Products

Bioinformatics Tool for Importin-7 Partial Recombinant Protein (H00010527-Q01)

Discover related pathways, diseases and genes to Importin-7 Partial Recombinant Protein (H00010527-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin-7 Partial Recombinant Protein (H00010527-Q01)

Discover more about diseases related to Importin-7 Partial Recombinant Protein (H00010527-Q01).
 

Pathways for Importin-7 Partial Recombinant Protein (H00010527-Q01)

View related products by pathway.

PTMs for Importin-7 Partial Recombinant Protein (H00010527-Q01)

Learn more about PTMs related to Importin-7 Partial Recombinant Protein (H00010527-Q01).

Blogs on Importin-7

There are no specific blogs for Importin-7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Importin-7 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IPO7