IMP4 Recombinant Protein Antigen

Images

 
There are currently no images for IMP4 Recombinant Protein Antigen (NBP2-55739PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IMP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IMP4.

Source: E.coli

Amino Acid Sequence: AQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IMP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55739 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for IMP4 Recombinant Protein Antigen

  • Brix domain-containing protein 4
  • BXDC4MGC19606
  • IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast)
  • U3 small nucleolar ribonucleoprotein protein IMP4
  • U3 snoRNP protein 4 homolog
  • U3 snoRNP protein IMP4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38232
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59475
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88525
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-80813
Species: Hu
Applications: IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
H00162540-Q01
Species: Hu
NBP1-81681
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-92481
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-30708
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55739PEP
Species: Hu
Applications: AC

Publications for IMP4 Recombinant Protein Antigen (NBP2-55739PEP) (0)

There are no publications for IMP4 Recombinant Protein Antigen (NBP2-55739PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMP4 Recombinant Protein Antigen (NBP2-55739PEP) (0)

There are no reviews for IMP4 Recombinant Protein Antigen (NBP2-55739PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for IMP4 Recombinant Protein Antigen (NBP2-55739PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IMP4 Products

Bioinformatics Tool for IMP4 Recombinant Protein Antigen (NBP2-55739PEP)

Discover related pathways, diseases and genes to IMP4 Recombinant Protein Antigen (NBP2-55739PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMP4 Recombinant Protein Antigen (NBP2-55739PEP)

Discover more about diseases related to IMP4 Recombinant Protein Antigen (NBP2-55739PEP).
 

Pathways for IMP4 Recombinant Protein Antigen (NBP2-55739PEP)

View related products by pathway.

PTMs for IMP4 Recombinant Protein Antigen (NBP2-55739PEP)

Learn more about PTMs related to IMP4 Recombinant Protein Antigen (NBP2-55739PEP).

Blogs on IMP4

There are no specific blogs for IMP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IMP4 Antibody
NBP2-55739
IGF2BP3 Antibody
NBP1-84339

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IMP4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IMP4